Overview

  • Product name
  • Description
    Rabbit polyclonal to TTLL7
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TTLL7 aa 568-638.
    Sequence:

    EEYQNKKREKQVTYNLKPSNHYKLIQQPSSIRRSVSCPRSISAQSPSSGD TRPFSAQQMISVSRPTSASRS


    Database link: Q6ZT98

  • Positive control
    • Human cerebellum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Polyglutamylase which preferentially modifies beta-tubulin. Involved in the side-chain initiation step of the polyglutamylation reaction rather than in the elongation step. Required for neurite growth.
  • Tissue specificity
    Highly expressed in the nervous system including spinal cord, thalamus, hippocampus, hypothalamus and cerebellum.
  • Sequence similarities
    Belongs to the tubulin--tyrosine ligase family.
    Contains 1 TTL domain.
  • Cellular localization
    Cell projection > cilium. Cytoplasm > cytoskeleton > cilium basal body. Cell projection > dendrite. Perikaryon. In cells with primary cilia, found in both cilia and basal bodies. In neuronal cells, found in dendrites and perikaryon.
  • Information by UniProt
  • Database links
  • Alternative names
    • RP5-836J3.2 antibody
    • Testis development protein NYD-SP30 antibody
    • Ttll7 antibody
    • TTLL7_HUMAN antibody
    • Tubulin polyglutamylase TTLL7 antibody
    • Tubulin tyrosine ligase like family member 7 antibody
    • Tubulin--tyrosine ligase-like protein 7 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling TTLL7 with ab185465 at 1/200 dilution.

References

ab185465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up