Anti-TUBA6 antibody - N-terminal (ab191299)

Overview

  • Product name
    Anti-TUBA6 antibody - N-terminal
    See all TUBA6 primary antibodies
  • Description
    Rabbit polyclonal to TUBA6 - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chicken, Hamster, Cow, Pig, Xenopus laevis, Drosophila melanogaster, Monkey
  • Immunogen

    Synthetic peptide within Human TUBA6 aa 26-60 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    LEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK


    Database link: Q9BQE3

  • Positive control
    • HT1080, T47D, Mouse brain and testis lysates,

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab191299 was purified through a protein A column, followed by peptide affinity purification.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 50 kDa.

Target

  • Function
    Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
  • Sequence similarities
    Belongs to the tubulin family.
  • Post-translational
    modifications
    Undergoes a tyrosination/detyrosination cycle, the cyclic removal and re-addition of a C-terminal tyrosine residue by the enzymes tubulin tyrosine carboxypeptidase (TTCP) and tubulin tyrosine ligase (TTL), respectively.
    Some glutamate residues at the C-terminus are polyglutamylated. This modification occurs exclusively on glutamate residues and results in polyglutamate chains on the gamma-carboxyl group. Also monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella) whereas glutamylation is prevalent in neuronal cells, centrioles, axonemes, and the mitotic spindle. Both modifications can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of such modifications is still unclear but they regulate the assembly and dynamics of axonemal microtubules.
    Acetylation of alpha-tubulins at Lys-40 stabilizes microtubules and affects affinity and processivity of microtubule motors. This modification has a role in multiple cellular functions, ranging from cell motility, cell cycle progression or cell differentiation to intracellular trafficking and signaling.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha tubulin 6 antibody
    • Alpha tubulin isotype M alpha 6 antibody
    • Alpha-tubulin 6 antibody
    • bcm948 antibody
    • M[a]6 antibody
    • TBA1C_HUMAN antibody
    • Tuba1c antibody
    • Tubulin alpha 1C chain antibody
    • tubulin alpha 6 antibody
    • Tubulin alpha 6 chain antibody
    • Tubulin alpha-1C chain antibody
    • Tubulin alpha-6 chain antibody
    • tubulin, alpha 1c antibody
    see all

Images

  • All lanes : Anti-TUBA6 antibody - N-terminal (ab191299) at 1/1000 dilution

    Lane 1 : HT1080 cell lysate
    Lane 2 : T47D cell lysate
    Lane 3 : Mouse brain tissue lysate
    Lane 4 : Mouse testis tissue lysate

    Lysates/proteins at 35 µg per lane.

    Secondary
    goat anti-rabbit IgG H&L(HRP) at 1/5000 dilution

    Predicted band size : 50 kDa

References

ab191299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up