Overview

  • Product nameAnti-Tubby antibody
    See all Tubby primary antibodies
  • Description
    Rabbit polyclonal to Tubby
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 0-49 (MGARTPLPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHR R) of Human Tubby (NP_003311)

  • Positive control
    • 293T cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Purification notesab82689 is purified by a peptide affinity chromatography method.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 62 kDa (predicted molecular weight: 62 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.

Target

  • RelevanceTubby is a bipartite transcription factor. It may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, which functions as a membrane bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis.
  • Cellular localizationCytoplasm. Nucleus. Secreted. Cell membrane. Binds phospholipid and is anchored to the plasma membrane through binding phosphatidylinositol 4,5-bisphosphate. Is released upon activation of phospholipase C. Translocates from the plasma membrane to the nucleus upon activation of guanine nucleotide-binding protein G(q) subunit alpha. Does not have a cleavable signal peptide and is secreted by a non-conventional pathway.
  • Database links
  • Alternative names
    • Mouse tubby homologue antibody
    • rd5 antibody
    • Retinal degeneration 5 antibody
    • TUB antibody
    • Tubby (mouse) homolog antibody
    • tubby antibody
    • Tubby homolog (mouse) antibody
    • Tubby homologue antibody
    • Tubby protein homolog antibody
    see all

Anti-Tubby antibody images

  • Anti-Tubby antibody (ab82689) at 1 µg/ml + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 62 kDa
    Observed band size : 62 kDa
    Additional bands at : 50 kDa. We are unsure as to the identity of these extra bands.

References for Anti-Tubby antibody (ab82689)

ab82689 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"