Overview

  • Product name
  • Description
    Rabbit polyclonal to TXNDC
  • Tested applications
    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cynomolgus monkey, Rhesus monkey, Gorilla
  • Immunogen

    Synthetic peptide within Human TXNDC aa 230-280. The exact sequence is proprietary. NP_110382.3
    Sequence:

    QPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDK S


    Database link: Q9H3N1

  • Positive control
    • Jurkat, 293T and HeLa whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab174660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 32 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Function
      May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions.
    • Tissue specificity
      Ubiquitous. Highly expressed in kidney, liver, placenta and lung.
    • Sequence similarities
      Contains 1 thioredoxin domain.
    • Cellular localization
      Membrane. Endoplasmic reticulum membrane. Predominantly found in the endoplasmic reticulum.
    • Information by UniProt
    • Database links
    • Alternative names
      • PDIA11 antibody
      • Protein disulfide isomerase family A, member 11 antibody
      • Thioredoxin domain containing 1 antibody
      • Thioredoxin domain containing antibody
      • Thioredoxin domain-containing protein 1 antibody
      • Thioredoxin-related transmembrane protein 1 antibody
      • TMX antibody
      • TMX1 antibody
      • TMX1_HUMAN antibody
      • Transmembrane Trx-related protein antibody
      • TXNDC antibody
      • TXNDC1 antibody
      see all

    Images

    • All lanes : Anti-TXNDC antibody (ab174660) at 0.10000000149 µg/ml

      Lane 1 : Jurkat whole cell lysate
      Lane 2 : 293T whole cell lysate
      Lane 3 : HeLa whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique

      Predicted band size : 32 kDa


      Exposure time : 3 minutes

    References

    ab174660 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab174660.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up