
  • Product nameAnti-TXNDC16 antibody
  • Description
    Rabbit polyclonal to TXNDC16
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 252-301 (LTEVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGK A) of Human TXNDC16, (NP_065835)

  • Positive control
    • Fetal brain lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab81248 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 94 kDa (predicted molecular weight: 94 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.


Anti-TXNDC16 antibody images

  • Anti-TXNDC16 antibody (ab81248) at 1 µg/ml + Human fetal brain lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 94 kDa
    Observed band size : 94 kDa

References for Anti-TXNDC16 antibody (ab81248)

ab81248 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81248.
Please use the links above to contact us or submit feedback about this product.