Overview

  • Product name
  • Description
    Rabbit polyclonal to TYK2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TYK2 aa 240-387.
    Sequence:

    RFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGE PCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGS SGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWAYFCDFRDITHVV


    Database link: P29597

  • Positive control
    • WB: PC-3 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human colon tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 134 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Probably involved in intracellular signal transduction by being involved in the initiation of type I IFN signaling. Phosphorylates the interferon-alpha/beta receptor alpha chain.
  • Tissue specificity
    Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
  • Involvement in disease
    Defects in TYK2 are the cause of protein-tyrosine kinase 2 deficiency (TYK2 deficiency) [MIM:611521]; also known as autosomal recessive hyper-IgE syndrome (HIES) with atypical mycobacteriosis. TYK2 deficiency consists of a primary immunodeficiency characterized by recurrent skin abscesses, pneumonia, and highly elevated serum IgE.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
    Contains 1 FERM domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • Domain
    The FERM domain mediates interaction with JAKMIP1.
  • Information by UniProt
  • Database links
  • Alternative names
    • JTK 1 antibody
    • JTK1 antibody
    • Non receptor tyrosine protein kinase 2 antibody
    • Non receptor tyrosine protein kinase TYK2 antibody
    • Non-receptor tyrosine-protein kinase TYK2 antibody
    • OTTHUMP00000232745 antibody
    • OTTHUMP00000232746 antibody
    • OTTHUMP00000232748 antibody
    • Protein Tyrosine Kinase 2 antibody
    • TYK 2 antibody
    • Tyk2 antibody
    • TYK2_HUMAN antibody
    • Tyrosine kinase 2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TYK2 (green) using ab223733 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human colon tissue stained for TYK2 using ab223733 at 1/20 dilution in immunohistochemical analysis.

  • Anti-TYK2 antibody (ab223733) at 1/100 dilution + PC-3 (human prostate adenocarcinoma cell line) cell lysate

    Predicted band size: 134 kDa

References

ab223733 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up