Overview

  • Product name
  • Description
    Rabbit polyclonal to Tyrosinase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Dog, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human Tyrosinase aa 20-340.
    Sequence:

    FPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQF PFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLV RRNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFND INIYDLFVWMHYYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRWE QEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFF SSWQIVCSRLEEYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVE FCLSLTQYESGSMDKAANFSF


    Database link: P14679

  • Positive control
    • HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab180753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 60 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.
  • Involvement in disease
    Defects in TYR are the cause of albinism oculocutaneous type 1A (OCA1A) [MIM:203100]; also known as tyrosinase negative oculocutaneous albinism. An autosomal recessive disorder in which the biosynthesis of melanin pigment is absent in skin, hair, and eyes. It is characterized by complete lack of tyrosinase activity due to production of an inactive enzyme. Patients present with a life-long absence of melanin pigment after birth, and manifest increased sensitivity to ultraviolet radiation with predisposition to skin cancer. Visual anomalies include decreased acuity, nystagmus, strabismus and photophobia.
    Defects in TYR are the cause of albinism oculocutaneous type 1B (OCA1B) [MIM:606952]; also known as albinism yellow mutant type. An autosomal recessive disorder in which the biosynthesis of melanin pigment is reduced in skin, hair, and eyes. It is characterized by partial lack of tyrosinase activity. Patients have white hair at birth that rapidly turns yellow or blond. They manifest the development of minimal-to-moderate amounts of cutaneous and ocular pigment. Some patients may have with white hair in the warmer areas (scalp and axilla) and progressively darker hair in the cooler areas (extremities). This variant phenotype is due to a loss of tyrosinase activity above 35-37 degrees C.
  • Sequence similarities
    Belongs to the tyrosinase family.
  • Cellular localization
    Melanosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATN antibody
    • CMM8 antibody
    • LB24 AB antibody
    • LB24-AB antibody
    • Monophenol monooxygenase antibody
    • OCA1 antibody
    • OCA1A antibody
    • OCAIA antibody
    • Oculocutaneous albinism IA antibody
    • SHEP3 antibody
    • SK29 AB antibody
    • SK29-AB antibody
    • Tumor rejection antigen AB antibody
    • TYR antibody
    • TYRO_HUMAN antibody
    • tyrosinase (oculocutaneous albinism IA) antibody
    • Tyrosinase antibody
    see all

Images

  • Immunofluorescence analysis of MCF7 cell using TYR antibody. Blue: DAPI for nuclear staining.

References

This product has been referenced in:
  • Challa AK  et al. Novel Hypomorphic Alleles of the Mouse Tyrosinase Gene Induced by CRISPR-Cas9 Nucleases Cause Non-Albino Pigmentation Phenotypes. PLoS One 11:e0155812 (2016). WB . Read more (PubMed: 27224051) »

See 1 Publication for this product

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (B16F10)
Gel Running Conditions
Reduced Denaturing (Criterion TGX 4- 15% (BioRad))
Loading amount
40 µg
Treatment
Control, treated with PTU 30 µg.mL-1 for 24h and treated with Quercetin, 37µg.mL-1 for 24h
Specification
B16F10
Blocking step
Milk as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Aug 17 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up