Overview

  • Product name
  • Description
    Rabbit polyclonal to UBE2Q2
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Cow
  • Immunogen

    Recombinant fragment corresponding to Human UBE2Q2 aa 1-200.
    Sequence:

    MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLP PPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLK WLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAED IEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVS


    Database link: Q8WVN8

  • Positive control
    • U2OS, mouse NIH 3T3 and rat INS-1 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab188238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
WB 1/2000. Predicted molecular weight: 43 kDa.

Target

Images

  • All lanes : Anti-UBE2Q2 antibody (ab188238) at 1/2000 dilution

    Lane 1 : Lysate from U2OS cells transfected with control sRNAi
    Lane 2 : Lysate from U2OS cells transfected with UBE2Q2 sRNAi
    Lane 3 : mouse NIH 3T3 cell lysate
    Lane 4 : rat INS-1 cell lysate

    Lysates/proteins at 40 µg per lane.


    Predicted band size : 43 kDa
  • Western blot analysis (using ab188238) of immunoprecipitation from U2OS cell extracts.

    Lane 1: Input

    Lane 2: immunoprecipitate with control serum+protein A sepharose.

    Lane 3: immunoprecipitate with ab188238+ protein A sepharose.

    .

References

ab188238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up