
  • Product nameAnti-UBL3 antibody
    See all UBL3 primary antibodies
  • Description
    Rabbit polyclonal to UBL3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 66-115 (FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC V) of Rat UBL3 (NP_001015030).

  • Positive control
    • Rat kidney lysate



Our Abpromise guarantee covers the use of ab113820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-UBL3 antibody images

  • Anti-UBL3 antibody (ab113820) at 1 µg/ml + Rat kidney lysate at 10 µg

    Predicted band size : 14 kDa

References for Anti-UBL3 antibody (ab113820)

ab113820 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113820.
Please use the links above to contact us or submit feedback about this product.