
  • Product name
    Anti-UBL3 antibody
  • Description
    Rabbit polyclonal to UBL3
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 66-115 (FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCC V) of Rat UBL3 (NP_001015030).

  • Positive control
    • Rat kidney lysate



Our Abpromise guarantee covers the use of ab113820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Anti-UBL3 antibody (ab113820) at 1 µg/ml + Rat kidney lysate at 10 µg

    Predicted band size: 14 kDa

    Gel concentration 10-20%


ab113820 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113820.
Please use the links above to contact us or submit feedback about this product.


Sign up