Overview

  • Product name
  • Description
    Rabbit polyclonal to UBL4A
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Orangutan
  • Immunogen

    Full length protein corresponding to Human UBL4A aa 1-157.
    Sequence:

    MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKAL ADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLIS KVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTET MEKGFSK


    Database link: NP_055050.1

  • Positive control
    • UBL4A transfected 293T cell line lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 18 kDa.

Target

  • Function
    Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.
  • Sequence similarities
    Contains 1 ubiquitin-like domain.
  • Cellular localization
    Cytoplasm > cytosol.
  • Information by UniProt
  • Database links
  • Alternative names
    • DX254E antibody
    • DXS254E antibody
    • G6PD antibody
    • GDX antibody
    • OTTHUMP00000061462 antibody
    • Ubiquitin like 4 antibody
    • Ubiquitin like 4A antibody
    • Ubiquitin like protein 4A antibody
    • Ubiquitin like protein GDX antibody
    • Ubiquitin-like protein 4A antibody
    • Ubiquitin-like protein GDX antibody
    • UBL 4 antibody
    • UBL 4A antibody
    • UBL4 antibody
    • Ubl4a antibody
    • UBL4A_HUMAN antibody
    see all

Images

  • All lanes : Anti-UBL4A antibody (ab172138) at 1 µg/ml

    Lane 1 : UBL4A transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-Rabbit IgG at 1/7500 dilution

    Predicted band size: 18 kDa

References

ab172138 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172138.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up