Overview

  • Product name
  • Description
    Mouse polyclonal to UCP2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Pig, Orangutan
  • Immunogen

    Full length protein corresponding to Human UCP2 aa 1-309.
    Sequence:

    MVGFKATDVPPTATVKFLGAGTAACIADLITFPLGTAKVRLQIQGESQGP VRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLY DSVKQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARA GGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLI KDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQY SSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ACTSREAPF


    Database link: AAH11737.1

  • Positive control
    • UCP2 transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa.

Target

Images

  • All lanes : Anti-UCP2 antibody (ab172135) at 1 µg/ml

    Lane 1 : UCP2 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-Mouse IgG at 1/2500 dilution

    Predicted band size: 33 kDa

References

ab172135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up