Overview

  • Product name
  • Description
    Rabbit polyclonal to UCP3
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human UCP3 aa 1-110.
    Sequence:

    MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAV QTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYD SVKQVYTPKG


    Database link: P55916

  • Positive control
    • Mouse testis, mouse liver and mouse lung cell line extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab180643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 34 kDa.
IHC-P 1/50 - 1/200.
ICC/IF Use at an assay dependent concentration.

Target

  • Function
    UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance.
  • Tissue specificity
    Only in skeletal muscle and heart. Is more expressed in glycolytic than in oxidative skeletal muscles.
  • Involvement in disease
    Defects in UCP3 may be involved in obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
  • Sequence similarities
    Belongs to the mitochondrial carrier family.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Form
    UCP3 is preferentially expressed in muscle
  • Alternative names
    • Mitochondrial uncoupling protein 3 antibody
    • SLC25A9 antibody
    • Solute carrier family 25 member 9 antibody
    • UCP 3 antibody
    • UCP3 antibody
    • UCP3_HUMAN antibody
    • Uncoupling protein 3 antibody
    • Uncoupling protein 3 mitochondrial proton carrier antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180643. Blue DAPI for nuclear staining.
  • All lanes : Anti-UCP3 antibody (ab180643) at 1/500 dilution

    Lane 1 : mouse testis cell line extract
    Lane 2 : mouse liver cell line extract
    Lane 3 : mouse lung cell line extract


    Predicted band size : 34 kDa

References

ab180643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up