Overview

  • Product nameAnti-UEVLD antibody
    See all UEVLD primary antibodies
  • Description
    Rabbit polyclonal to UEVLD
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGG E) of Human UEVLD (NP_060784).

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPossible negative regulator of polyubiquitination.
  • Tissue specificityColon, colon carcinoma cell lines, normal cervical epithelium, carcinomas of the uterine cervix and peripheral blood leukocytes.
  • Sequence similaritiesIn the N-terminal section; belongs to the ubiquitin-conjugating enzyme family. UEV subfamily.
    In the C-terminal section; belongs to the LDH/MDH superfamily.
    Contains 1 UEV (ubiquitin E2 variant) domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 8430408E05Rik antibody
    • ATTP antibody
    • EV and lactate malate dehydrogenase domain containing protein antibody
    • EV and lactate/malate dehydrogenase domain-containing protein antibody
    • FLJ11068 antibody
    • signaling molecule ATTP antibody
    • ubiquitin conjugating enzyme E2 like antibody
    • Ubiquitin conjugating enzyme E2 variant 3 antibody
    • Ubiquitin E2 variant and lactate/malate dehydrogenase domain containing protein antibody
    • Ubiquitin-conjugating enzyme E2 variant 3 antibody
    • UEV 3 antibody
    • UEV and lactate malate dehyrogenase domains antibody
    • UEV-3 antibody
    • UEV2 and LDH domains containing protein antibody
    • UEV3 antibody
    • uevld antibody
    • UEVLD_HUMAN antibody
    see all

Anti-UEVLD antibody images

  • Anti-UEVLD antibody (ab99133) at 1 µg/ml + 721_B cell lysate at 10 µg

    Predicted band size : 52 kDa

References for Anti-UEVLD antibody (ab99133)

ab99133 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"