Overview

  • Product name
    Anti-UEVLD antibody
  • Description
    Rabbit polyclonal to UEVLD
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGG E) of Human UEVLD (NP_060784).

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Possible negative regulator of polyubiquitination.
  • Tissue specificity
    Colon, colon carcinoma cell lines, normal cervical epithelium, carcinomas of the uterine cervix and peripheral blood leukocytes.
  • Sequence similarities
    In the N-terminal section; belongs to the ubiquitin-conjugating enzyme family. UEV subfamily.
    In the C-terminal section; belongs to the LDH/MDH superfamily.
    Contains 1 UEV (ubiquitin E2 variant) domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 8430408E05Rik antibody
    • ATTP antibody
    • EV and lactate malate dehydrogenase domain containing protein antibody
    • EV and lactate/malate dehydrogenase domain-containing protein antibody
    • FLJ11068 antibody
    • signaling molecule ATTP antibody
    • ubiquitin conjugating enzyme E2 like antibody
    • Ubiquitin conjugating enzyme E2 variant 3 antibody
    • Ubiquitin E2 variant and lactate/malate dehydrogenase domain containing protein antibody
    • Ubiquitin-conjugating enzyme E2 variant 3 antibody
    • UEV 3 antibody
    • UEV and lactate malate dehyrogenase domains antibody
    • UEV-3 antibody
    • UEV2 and LDH domains containing protein antibody
    • UEV3 antibody
    • uevld antibody
    • UEVLD_HUMAN antibody
    see all

Images

  • Anti-UEVLD antibody (ab99133) at 1 µg/ml + 721_B cell lysate at 10 µg

    Predicted band size : 52 kDa

References

ab99133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up