Overview

  • Product nameAnti-UPB1 antibody
    See all UPB1 primary antibodies
  • Description
    Rabbit polyclonal to UPB1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 287-336 (

    NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG

    ) of Human UPB1 (NP_057411).

  • Positive control
    • OVCAR3 lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceUPB1, also known as beta ureidopropionase, belongs to the CN hydrolase family. It catalyzes the last step in the pyrimidine degradation pathway in which the pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively.
  • Cellular localizationCytoplasmic
  • Database links
  • Alternative names
    • AI195023 antibody
    • Beta alanine synthase antibody
    • Beta ureidopropionase antibody
    • BUP1 antibody
    • N carbamoyl beta alanine amidohydrolase antibody
    • Ureidopropionase, beta antibody
    see all

Anti-UPB1 antibody images

  • Anti-UPB1 antibody (ab99185) at 1 µg/ml + OVCAR2 Cell Lysate at 10 µg

    Predicted band size : 43 kDa

References for Anti-UPB1 antibody (ab99185)

ab99185 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"