Anti-Uridine Phosphorylase 1 antibody (ab185680)

Overview

  • Product name
    Anti-Uridine Phosphorylase 1 antibody
    See all Uridine Phosphorylase 1 primary antibodies
  • Description
    Rabbit polyclonal to Uridine Phosphorylase 1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Uridine Phosphorylase 1 aa 4-47 (N terminal).
    Sequence:

    TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP


    Database link: Q16831

  • Positive control
    • Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
  • Pathway
    Pyrimidine metabolism; UMP biosynthesis via salvage pathway; uracil from uridine (phosphorylase route): step 1/1.
  • Sequence similarities
    Belongs to the PNP/UDP phosphorylase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • UDRPASE antibody
    • UP antibody
    • UPase 1 antibody
    • UPASE antibody
    • UPP antibody
    • Upp1 antibody
    • UPP1_HUMAN antibody
    • UrdPase 1 antibody
    • Uridine phosphorylase 1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling Uridine Phosphorylase 1 with ab185680 at 1/50 dilution.

References

ab185680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Baboon Tissue sections (Adult testis)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Sodium citrate
Permeabilization
No
Specification
Adult testis
Blocking step
5% serum + 3% BSA as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: RT°C
Fixative
Paraformaldehyde
Username

Abcam user community

Verified customer

Submitted Mar 31 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up