Overview

  • Product nameAnti-USP22 antibody
    See all USP22 primary antibodies
  • Description
    Rabbit polyclonal to USP22
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 71-120 (RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIY D) of Human USP22 (NP_056091)

  • Positive control
    • Fetal heart lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab82986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 60 kDa (predicted molecular weight: 60 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • FunctionHistone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. Recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation and cell cycle progression.
  • Tissue specificityModerately expressed in various tissues including heart and skeletal muscle, and weakly expressed in lung and liver.
  • Sequence similaritiesBelongs to the peptidase C19 family. UBP8 subfamily.
    Contains 1 UBP-type zinc finger.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Deubiquitinating enzyme 22 antibody
    • KIAA1063 antibody
    • Ubiquitin carboxyl terminal hydrolase 22 antibody
    • Ubiquitin carboxyl-terminal hydrolase 22 antibody
    • Ubiquitin specific peptidase 22 antibody
    • Ubiquitin specific peptidase 3 like antibody
    • Ubiquitin specific processing protease 22 antibody
    • Ubiquitin specific protease 22 antibody
    • Ubiquitin thioesterase 22 antibody
    • Ubiquitin thiolesterase 22 antibody
    • Ubiquitin-specific-processing protease 22 antibody
    • UBP22_HUMAN antibody
    • USP 22 antibody
    • Usp22 antibody
    • USP3L antibody
    see all

Anti-USP22 antibody images

  • Anti-USP22 antibody (ab82986) at 1 µg/ml + Fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 60 kDa
    Observed band size : 60 kDa
    Additional bands at : 40 kDa. We are unsure as to the identity of these extra bands.

References for Anti-USP22 antibody (ab82986)

ab82986 has not yet been referenced specifically in any publications.

Product Wall

Application Immunocytochemistry/ Immunofluorescence
Sample Human Cell (HeLa)
Permeabilization Yes - 0.5% TritonX100 in PBS
Specification HeLa
Fixative Paraformaldehyde
Username

Dr. Kirk McManus

Verified customer

Submitted Aug 15 2016

Application Western blot
Sample Zebrafish Cell lysate - whole cell (Whole embryo)
Gel Running Conditions Reduced Denaturing (10% Bis-Tris gel with MES running buffer)
Loading amount 60 µg
Specification Whole embryo
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Mr. Stephen Moore

Verified customer

Submitted Jun 09 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"