Overview

  • Product nameAnti-USP36 antibody
    See all USP36 primary antibodies
  • Description
    Rabbit polyclonal to USP36
  • Tested applicationsSuitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Horse, Dog, Chimpanzee, Rhesus monkey, Gorilla, Orangutan, Bat
  • Immunogen

    Synthetic peptide corresponding to amino acids 1070 - 1121 of Human USP36 (

    WDEEFDRGKEKKIKKFKREKRRNFNAFQKLQTRRNFWSVTHPAKAASLSY RR

    )(NP_079366.2)

  • Positive control
    • Human tissues - Breast Carcinoma, Colon Carcinoma, Non-Small Cell Lung Cancer, Ovarian Carcinoma, Prostate Carcinoma, Stomach Adenocarcinoma and Testicular Seminoma.

Properties

Applications

Our Abpromise guarantee covers the use of ab93771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P
  • Application notesIHC-P: 1/100 - 1/500. Epitope exposure is recommended.
    Epitope exposure with tris-EDTA pH 9.0 buffer will enhance staining.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • FunctionMay be required for maintaining multiple types of adult stem cells. May function as a transcriptional repressor by continually deubiquiting histone H2B at the promoters of genes critical for cellular differentiation, thereby preventing histone H3 'Lys-4' trimethylation (H3K4).
    • Tissue specificityBroadly expressed.
    • Sequence similaritiesBelongs to the peptidase C19 family.
    • Cellular localizationNucleus > nucleolus.
    • Information by UniProt
    • Database links
    • Alternative names
      • Deubiquitinating enzyme 1 antibody
      • Deubiquitinating enzyme 36 antibody
      • DUB1 antibody
      • FLJ12851 antibody
      • KIAA1453 antibody
      • Ubiquitin carboxyl-terminal hydrolase 36 antibody
      • Ubiquitin specific peptidase 36 antibody
      • Ubiquitin specific processing protease 36 antibody
      • Ubiquitin thioesterase 36 antibody
      • Ubiquitin thiolesterase 36 antibody
      • Ubiquitin-specific-processing protease 36 antibody
      • UBP36_HUMAN antibody
      • Usp36 antibody
      see all

    Anti-USP36 antibody images

    • ab93771, at a 1/250 dilution staining USP36 in a formalin fixed parafin embedded section of Human breast carcinoma. Epitope Retrieval was performed using a high pH buffer.

    References for Anti-USP36 antibody (ab93771)

    ab93771 has not yet been referenced specifically in any publications.

    Product Wall

    Abcam has not validated the combination of species/application used in this Abreview.
    Application Immunocytochemistry/ Immunofluorescence
    Sample Human Cell (HeLa)
    Permeabilization Yes - 0.5% TritonX100 in PBS
    Specification HeLa
    Fixative Paraformaldehyde
    Username

    Dr. Kirk McManus

    Verified customer

    Submitted May 20 2016

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"