Overview

  • Product nameAnti-VDAC1/Porin antibody
    See all VDAC1/Porin primary antibodies
  • Description
    Rabbit polyclonal to VDAC1/Porin
  • Specificityab28777 recognises Outer mitochondrial membrane protein porin (VDAC1).
  • Tested applicationsIHC-P, WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human VDAC1/Porin aa 234-283 (C terminal).
    Sequence:

    SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

  • Positive control
    • HepG2 cell lysate. Human liver tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab28777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 1.25 µg/ml. Predicted molecular weight: 31 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/312500.

Target

  • FunctionForms a channel through the mitochondrial outer membrane and also the plasma membrane. The channel at the outer mitochondrial membrane allows diffusion of small hydrophilic molecules; in the plasma membrane it is involved in cell volume regulation and apoptosis. It adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
  • Tissue specificityHeart, liver and skeletal muscle.
  • Sequence similaritiesBelongs to the eukaryotic mitochondrial porin family.
  • DomainConsists mainly of a membrane-spanning beta-barrel formed by 19 beta-strands. The helical N-terminus folds back into the pore opening and plays a role in voltage-gated channel activity.
  • Cellular localizationMitochondrion outer membrane. Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • N2441 antibody
    • OMP2 antibody
    • POR1 antibody
    • hVDAC1 antibody
    • MGC111064 antibody
    • Mitochondrial Porin antibody
    • Outer mitochondrial membrane protein porin 1 antibody
    • Plasmalemmal porin antibody
    • Porin 31HL antibody
    • Porin 31HM antibody
    • VDAC antibody
    • VDAC-1 antibody
    • Vdac1 antibody
    • VDAC1_HUMAN antibody
    • Voltage dependent anion channel 1 antibody
    • Voltage dependent anion selective channel protein 1 antibody
    • Voltage-dependent anion-selective channel protein 1 antibody
    • YNL055C antibody
    • YNL2441C antibody
    see all

Anti-VDAC1/Porin antibody images



  • Predicted band size : 31 kDa
    Western blot analysis of HepG2 cell lysate labeling VDAC/Porin with ab28777 at 1.25µg/ml.


  • Predicted band size : 31 kDa
    Western blot analysis of HeLa (lane 1) 293T (lane 2) K562 (lane 3) MDA-MB-231 (lane 4) cell lysates (50µg/ml) labeling VDAC/Porin with ab28777 at 1:1000.A HRP-conjugated anti-rabbit (1:1000) was used as the secondary antibody.
  • Anti-VDAC1/Porin antibody (ab28777) at 1.25 µg/ml + HepG2 cell lysate

    Secondary
    HRP conjugated anti-Rabbit IgG

    Predicted band size : 31 kDa
    Observed band size : 32 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 42 kDa. We are unsure as to the identity of these extra bands.
    Gel concentration 12%
  • ab28777, at a concentration of 6.0µg/ml, staining human VDAC1 in (liver) by Immunohistochemistry, Paraffin embedded tissue. Arrows indicate positively labelled cells (hepatocytes). Magnification 400X.ab28777, at a concentration of 6.0µg/ml, staining human VDAC1 in (liver) by Immunohistochemistry, Paraffin embedded tissue. Arrows indicate positively labelled cells (hepatocytes). Magnification 400X.

References for Anti-VDAC1/Porin antibody (ab28777)

This product has been referenced in:
  • Mancias JD  et al. Quantitative proteomics identifies NCOA4 as the cargo receptor mediating ferritinophagy. Nature 509:105-9 (2014). WB ; Human . Read more (PubMed: 24695223) »
  • Rousset F  et al. Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes. PLoS One 8:e66478 (2013). Read more (PubMed: 23840483) »

See all 4 Publications for this product

Product Wall

Thank you for contacting Abcam.

I am sorry about the issues you have been having with ab28777 in western blot and I do understand why you are concerned about the results you have been receiving with the antibody. As requested I am sending you...

Read More

Thank you for your reply and for providing that extra information.

From the image that you have submitted, it does look as though the antibody ab28777 is detecting a band at about 50kDa, rather than 32kDa. But the band it is detecting is pret...

Read More

Thank you for contacting Abcam.

I am sorry about the issues you are having with ab28777. The antibody is covered under our Abpromise for six months and is guaranteed to work in western blot onhumansamples . If we cannot resolve the issue you ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"