Overview

  • Product nameAnti-VEGFR 1+VEGFR 2 antibody
  • Description
    Rabbit polyclonal to VEGFR 1+VEGFR 2
  • SpecificityThis antibody is specific for VEGFR 1 with significant cross-reactivity with the VEGFR 2 protein.
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to Mouse VEGFR 1+VEGFR 2 aa 800-900.
    Sequence:

    PDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK VVQASAFG IKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGAC TK

  • Positive control
    • HUVEC lysate

Applications

Our Abpromise guarantee covers the use of ab36844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/1000. Predicted molecular weight: 150 kDa.

Target

  • RelevanceReceptors for VEGF, VEGFB and PGF have a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. VEGF and its high-affinity binding receptors, the tyrosine kinases FLK1 and FLT1, are thought to be important for the development of embryonic vasculature. It has been shown that an alternately spliced form of FLT1 produces a soluble protein, termed sFLT1, which binds vascular endothelial growth factor with high affinity, playing an inhibitory role in angiogenesis.
  • Cellular localizationCell Membrane
  • Database links
  • Alternative names
    • FLK1 antibody
    • FLT1 antibody
    • KDR antibody
    • Kinase insert domain receptor antibody
    • Vascular endothelial growth factor receptor 1 antibody
    • Vascular endothelial growth factor receptor 2 antibody
    • Vascular permeability factor receptor antibody
    • VEGFR antibody
    • VEGFR1 antibody
    see all

References for Anti-VEGFR 1+VEGFR 2 antibody (ab36844)

This product has been referenced in:
  • Nusrat O  et al. The Role of Angiogenesis in the Persistence of Chemoresistance in Epithelial Ovarian Cancer. Reprod Sci 23:1484-1492 (2016). Read more (PubMed: 27122375) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab36844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"