Overview

  • Product name
  • Description
    Mouse polyclonal to Versican
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Versican aa 1-349.
    Sequence:

    MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMP TLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGR VSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGV VFHYRAATSRYTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGW LADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYDVYCYVDHLDG DVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKRKC LIPF


    Database link: P13611

  • Positive control
    • Versican transfected 293T cell line.

Properties

Applications

Our Abpromise guarantee covers the use of ab171887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 373 kDa.

Target

  • Function
    May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
  • Tissue specificity
    Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissues except medulloblastomas.
  • Involvement in disease
    Defects in VCAN are the cause of Wagner syndrome type 1 (WGN1) [MIM:143200]. WGN is a dominantly inherited vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia. Systemic manifestations are absent in WGN.
  • Sequence similarities
    Belongs to the aggrecan/versican proteoglycan family.
    Contains 1 C-type lectin domain.
    Contains 2 EGF-like domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 2 Link domains.
    Contains 1 Sushi (CCP/SCR) domain.
  • Developmental stage
    Disappears after the cartilage development.
  • Post-translational
    modifications
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • Chondroitin sulfate proteoglycan 2 antibody
    • Chondroitin sulfate proteoglycan core protein 2 antibody
    • Chondroitin sulfate proteoglycan core protein, cartilage antibody
    • CSPG2 antibody
    • CSPG2_HUMAN antibody
    • ERVR antibody
    • GHAP antibody
    • Glial hyaluronate binding protein antibody
    • Glial hyaluronate-binding protein antibody
    • Large fibroblast proteoglycan antibody
    • PG-M antibody
    • PGM antibody
    • VCAN antibody
    • Versican antibody
    • Versican core protein antibody
    • Versican proteoglycan antibody
    • WGN 1 antibody
    • WGN antibody
    • WGN1 antibody
    see all

Images

  • All lanes : Anti-Versican antibody (ab171887) at 1 µg/ml

    Lane 1 : Versican transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 373 kDa

References

ab171887 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up