Overview

  • Product name
  • Description
    Rabbit polyclonal to VILIP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, Flow Cyt, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to Human VILIP1 aa 46-75 (internal sequence).
    Sequence:

    EEFQQLYVKFFPYGDASKFAQHAFRTFDKN


    Database link: P62760

  • Positive control
    • Formalin-Fixed, Paraffin-Embedded Human brain cerebellum and cortex tissue, 283 cells, Mouse heart lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab190155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/10 - 1/100.
Flow Cyt 1/10 - 1/50.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

WB 1/1000. Predicted molecular weight: 22 kDa.

Target

  • Function
    Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
  • Tissue specificity
    Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level).
  • Sequence similarities
    Belongs to the recoverin family.
    Contains 4 EF-hand domains.
  • Information by UniProt
  • Database links
  • Alternative names
    • 21 kDa CABP antibody
    • Hippocalcin like protein 3 antibody
    • Hippocalcin-like protein 3 antibody
    • HLP 3 antibody
    • HLP3 antibody
    • HPCAL 3 antibody
    • HPCAL3 antibody
    • HUVISL1 antibody
    • Neural visinin-like protein 1 antibody
    • Neural visinin-like type 1 protein antibody
    • Neurocalcin alpha antibody
    • NVL 1 antibody
    • NVL1 antibody
    • Nvp1 antibody
    • OZ1 antibody
    • Ratnvp1 antibody
    • VILIP antibody
    • VILIP-1 antibody
    • Visinin antibody
    • Visinin like 1 antibody
    • Visinin like protein 1 antibody
    • Visinin-like protein 1 antibody
    • VISL 1 antibody
    • VISL1 antibody
    • VISL1_HUMAN antibody
    • VLP-1 antibody
    • Vnsl1 antibody
    • Vsnl1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain cerebellum tissue labeling VILIP1 with ab190155 at 1/10 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain cortex tissue labeling VILIP1 with ab190155 at 1/10 dilution.

  • Flow cytometric analysis of 293 cells (right histogram) compared to a negative control cell (left histogram) labeling VILIP1 with ab190155 at 1/10 dilution. FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

  • Anti-VILIP1 antibody (ab190155) at 1/1000 dilution + Mouse heart tissue lysates at 35 µg

    Predicted band size: 22 kDa

  • All lanes : Anti-VILIP1 antibody (ab190155) at 1/1000 dilution

    Lane 1 : Non-transfected 293 cell lysates
    Lane 2 : VILIP1-transfected 293 cell lysates

    Lysates/proteins at 2 µg per lane.

    Predicted band size: 22 kDa

References

ab190155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up