
  • Product name
  • Description
    Rabbit polyclonal to VMAT1
  • Host species
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 476-525 (YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHE E) of Human VMAT1, NP_003044

  • Positive control
    • 293T cell lysate



Our Abpromise guarantee covers the use of ab86325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 2.5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Immunohistochemistry (Formalin/PFA fixed paraffin-embedded sections) analysis of human brain cortex tissue labeling VMAT1 with ab86325.

  • Anti-VMAT1 antibody (ab86325) at 1 µg/ml + 293T cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 56 kDa

    Gel concentration: 12%
    We are unsure as to the identity of the extra band.
  • Immunohistochemistry (Formalin/PFA fixed paraffin-embedded sections) analysis of human brain cortex tissue labeling VMAT1 with ab86325 at 2.5ug/ml. HRP/DAB detection.


ab86325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86325.
Please use the links above to contact us or submit feedback about this product.


Sign up