
  • Product name
  • Description
    Rabbit polyclonal to VMAT1
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 476-525 (YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHE E) of Human VMAT1, NP_003044

  • Positive control
    • 293T cell lysate



Our Abpromise guarantee covers the use of ab86325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 2.5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-VMAT1 antibody images

  • Immunohistochemistry (Formalin/PFA fixed paraffin-embedded sections) analysis of human brain cortex tissue labeling VMAT1 with ab86325.

  • Anti-VMAT1 antibody (ab86325) at 1 µg/ml + 293T cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 56 kDa
    Gel concentration: 12%
    We are unsure as to the identity of the extra band.
  • Immunohistochemistry (Formalin/PFA fixed paraffin-embedded sections) analysis of human brain cortex tissue labeling VMAT1 with ab86325 at 2.5ug/ml. HRP/DAB detection.

References for Anti-VMAT1 antibody (ab86325)

ab86325 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86325.
Please use the links above to contact us or submit feedback about this product.


Sign up