Overview

  • Product name
    Anti-Von Willebrand Factor antibody [3E2D10]
    See all Von Willebrand Factor primary antibodies
  • Description
    Mouse monoclonal [3E2D10] to Von Willebrand Factor
  • Tested applications
    Suitable for: Flow Cyt, WB, IP, ICC/IF, IHC-P, IHC-Frmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Von Willebrand Factor aa 845-949.
    Sequence:

    GCNTCVCQDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLV QDYCGSNPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVK RPMKD


    Database link: P04275

  • Positive control
    • HUVEC cells or Tonsil

Properties

Applications

Our Abpromise guarantee covers the use of ab194405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 0.5-1µl for 106 cells. ab170190-Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 309 kDa.
IP Use at 0.25-500 µg/mg of lysate.
ICC/IF Use a concentration of 0.5 - 1 µg/ml.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
IHC-Fr Use a concentration of 0.5 - 1 µg/ml.

Target

  • Function
    Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex GPIb-IX-V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma.
  • Tissue specificity
    Plasma.
  • Involvement in disease
    Defects in VWF are the cause of von Willebrand disease (VWD) [MIM:277480]. VWD defines a group of hemorrhagic disorders in which the von Willebrand factor is either quantitatively or qualitatively abnormal resulting in altered platelet function. Symptoms vary depending on severity and disease type but may include prolonged bleeding time, deficiency of factor VIII and impaired platelet adhesion. Type I von Willebrand disease is the most common form and is characterized by partial quantitative plasmatic deficiency of an otherwise structurally and functionally normal Willebrand factor; type II is associated with a qualitative deficiency and functional anomalies of the Willebrand factor; type III is the most severe form and is characterized by total or near-total absence of Willebrand factor in the plasma and cellular compartments, also leading to a profound deficiency of plasmatic factor VIII.
  • Sequence similarities
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 4 TIL (trypsin inhibitory-like) domains.
    Contains 3 VWFA domains.
    Contains 3 VWFC domains.
    Contains 4 VWFD domains.
  • Domain
    The von Willebrand antigen 2 is required for multimerization of vWF and for its targeting to storage granules.
  • Post-translational
    modifications
    All cysteine residues are involved in intrachain or interchain disulfide bonds.
    N- and O-glycosylated.
  • Cellular localization
    Secreted. Secreted > extracellular space > extracellular matrix. Localized to storage granules.
  • Information by UniProt
  • Database links
  • Alternative names
    • Coagulation factor VIII antibody
    • Coagulation factor VIII VWF antibody
    • F8VWF antibody
    • Factor VIII related antigen antibody
    • von Willebrand antigen 2 antibody
    • von Willebrand antigen II antibody
    • Von Willebrand disease antibody
    • VWD antibody
    • vWF antibody
    • VWF_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human tonsil tissue labeling Von Willebrand Factor with ab194405 at 1.0 µg/mL.

References

This product has been referenced in:
  • Yue X  et al. Endothelial lipase is upregulated by interleukin-6 partly via the p38 MAPK and p65 NF-?B signaling pathways. Mol Med Rep 14:1979-85 (2016). Human . Read more (PubMed: 27430252) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up