
  • Product nameAnti-VPS37A antibody
  • Description
    Rabbit polyclonal to VPS37A
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    A synthetic peptide corresponding to a region within the N terminal amino acids 1-50 (SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDV E) of Human VPS37A (NP_689628).

  • Positive control
    • MCF7 nuclear lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab85843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • RelevanceVPS37A, vacuolar protein sorting 37A, is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. It is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies and may be involved in cell growth and differentiation.
  • Cellular localization Late endosome membrane; Peripheral membrane protein. Nucleus.
  • Database links
  • Alternative names
    • 2210018P21Rik antibody
    • 4930592A21Rik antibody
    • AW261445 antibody
    • D8Ertd531e antibody
    • ESCRT I complex subunit VPS37A antibody
    • FLJ32642 antibody
    • FLJ42616 antibody
    • HCRP1 antibody
    • hepatocellular carcinoma related protein 1 antibody
    • hVps37A antibody
    • MGC116266 antibody
    • polyglutamine binding protein 2 antibody
    • PQBP2 antibody
    • vacuolar protein sorting 37A antibody
    • Vacuolar protein sorting associated protein 37A antibody
    see all

Anti-VPS37A antibody images

  • Anti-VPS37A antibody (ab85843) at 1 µg/ml + MCF7 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 45 kDa
    Observed band size : 45 kDa

References for Anti-VPS37A antibody (ab85843)

ab85843 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85843.
Please use the links above to contact us or submit feedback about this product.