
  • Product name
    Anti-VPS37A antibody
  • Description
    Rabbit polyclonal to VPS37A
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    A synthetic peptide corresponding to a region within the N terminal amino acids 1-50 (SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDV E) of Human VPS37A (NP_689628).

  • Positive control
    • MCF7 nuclear lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab85843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    VPS37A, vacuolar protein sorting 37A, is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. It is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies and may be involved in cell growth and differentiation.
  • Cellular localization
    Late endosome membrane; Peripheral membrane protein. Nucleus.
  • Database links
  • Alternative names
    • 2210018P21Rik antibody
    • 4930592A21Rik antibody
    • AW261445 antibody
    • D8Ertd531e antibody
    • ESCRT I complex subunit VPS37A antibody
    • FLJ32642 antibody
    • FLJ42616 antibody
    • HCRP1 antibody
    • hepatocellular carcinoma related protein 1 antibody
    • hVps37A antibody
    • MGC116266 antibody
    • polyglutamine binding protein 2 antibody
    • PQBP2 antibody
    • vacuolar protein sorting 37A antibody
    • Vacuolar protein sorting associated protein 37A antibody
    see all


  • Anti-VPS37A antibody (ab85843) at 1 µg/ml + MCF7 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 45 kDa
    Observed band size: 45 kDa


ab85843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85843.
Please use the links above to contact us or submit feedback about this product.


Sign up