Overview

  • Product name
  • Description
    Rabbit polyclonal to WASF2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human WASF2 aa 253-304.
    Sequence:

    DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPP AP


    Database link: Q9Y6W5

  • Positive control
    • Human vagina tissue; U-2OS cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex.
  • Tissue specificity
    Expressed in all tissues with strongest expression in placenta, lung, and peripheral blood leukocytes, but not in skeletal muscle.
  • Sequence similarities
    Belongs to the SCAR/WAVE family.
    Contains 1 WH2 domain.
  • Domain
    Binds and activates the Arp2/3 complex via the C-terminal domain. Interacts with actin via the WH2 domain.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection > lamellipodium. At the interface between the lamellipodial actin meshwork and the membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • DICTYOSTELIUM antibody
    • dJ393P12.2 antibody
    • IMD2 antibody
    • Protein WAVE-2 antibody
    • Putative Wiskott Aldrich syndrome protein family member 4 antibody
    • SCAR 2 antibody
    • SCAR antibody
    • SCAR2 antibody
    • Suppressor of cyclic-AMP receptor (WASP family) antibody
    • Verprolin homology domain-containing protein 2 antibody
    • WASF2 antibody
    • WASF2_HUMAN antibody
    • WASF4 antibody
    • WASP family protein member 2 antibody
    • WASP family protein member 4 antibody
    • WASP family Verprolin homologous protein 2 antibody
    • WASP-family protein member 2 antibody
    • WAVE 2 antibody
    • WAVE2 antibody
    • Wiskott-Aldrich syndrome protein family member 2 antibody
    • Wiskott-Aldrich syndrome protein family verprolin-homologous protein antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human vagina tissue labeling WASF2 with ab204376 at 1/200 dilution. 

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2OS cells labeling WASF2 with ab204376 at 4 µg/ml (green).

References

ab204376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Primary (Adult) Murine Fibroblasts)
Permeabilization
Yes - %0.3 Triton-X 100
Specification
Primary (Adult) Murine Fibroblasts
Blocking step
BSA as blocking agent for 24 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
Fixative
Formaldehyde
Username

Gokhan Yilmaz

Verified customer

Submitted Jun 30 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up