Overview

  • Product name
    Anti-WASH4P antibody
  • Description
    Rabbit polyclonal to WASH4P
  • Tested applications
    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human WASH4P aa 363-477.
    Sequence:

    GAPREVVDPSGGWATLLESIRQAGGIGKAKLRSMKERKLEKKKQKEQEQV RATSQGGHLMSDLFNKLVMRHKGISGKGPGAGEGPGGAFARVSDSIPPLP PPQQPQVDEDEDDWES


    Database link: A8MWX3

  • Positive control
    • IHC-P: Human testis tissue WB: Human RT-4 and U-251 MG cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab121151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    Acts as a nucleation-promoting factor at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization, playing a key role in the fission of tubules that serve as transport intermediates during endosome sorting.
  • Database links
  • Alternative names
    • FAM39CP antibody
    • Putative WAS protein family homolog 4 antibody

Images

  • Immunohistochemical staining of WASH3P in Human testis tissue, using ab121151 at a 1/1000 dilution. The image shows strong nuclear positivity in cells of seminiferus ducts.
  • All lanes : Anti-WASH4P antibody (ab121151) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : A-431 cell lysate
    Lane 4 : Liver cell lysate
    Lane 5 : Tonsil cell lysate
  • Immunofluorescent staining of Human cell line U-251MG shows positivity in vesicles using ab121151.
    Recommended treatment:
    Fixation/Permeabilization: PFA/Triton X-100

References

ab121151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up