Overview

  • Product name
  • Description
    Rabbit polyclonal to WBP2NL
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human WBP2NL aa 65-290.
    Sequence:

    SISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFK LVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMC TPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASP VRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPA GNEGPPAGYRASPAGSGARPHESTAA


    Database link: BC022546

  • Positive control
    • Human fetal stomach tissue lysate; Human fetal testis tissue

Properties

  • Form
    Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 98% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab170115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 32 kDa.

Target

  • Relevance
    WBP2NL is a sperm specific WW domain binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization.
  • Database links
  • Alternative names
    • FLJ26145 antibody
    • MGC26816 antibody
    • OTTHUMP00000028745 antibody
    • PAWP antibody
    • Postacrosomal sheath WW domain binding protein antibody
    • WBP2 N terminal like antibody
    • WBP2 NL antibody
    • WW domain binding protein 2 like antibody
    see all

Images

  • Anti-WBP2NL antibody (ab170115) at 1/500 dilution + Human fetal stomach lysate

    Predicted band size : 32 kDa
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal testis tissue labeling WBP2NL with ab170115 at 1/100.

References

ab170115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up