Overview

  • Product name
    Anti-WDFY2 antibody
  • Description
    Rabbit polyclonal to WDFY2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human WDFY2 aa 176-346. (BC014004).
    Sequence:

    SGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIM WDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVER QETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKC SSKRSSIPLMGFEFEVRVCDS


    Database link: Q96P53

  • Positive control
    • HeLa, HepG2, Jurkat, A549, MCF7 and mouse kidney lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 45 kDa.

Target

Images

  • All lanes : Anti-WDFY2 antibody (ab176895) at 1/500 dilution

    Lane 1 : HeLa lysate
    Lane 2 : HepG2 lysate
    Lane 3 : Jurkat lysate
    Lane 4 : A549 lysate
    Lane 5 : MCF7 lysate
    Lane 6 : Mouse kidney lysate

    Developed using the ECL technique.

    Predicted band size: 45 kDa

References

ab176895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up