Overview

  • Product name
  • Description
    Rabbit polyclonal to WDR42A
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
  • Immunogen

    Synthetic peptide within Human WDR42A aa 50-100. The exact sequence is proprietary. (NP_056541.2).
    Sequence:

    LTGDDGGPNRTSTESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRS E


    Database link: Q5TAQ9

  • Positive control
    • HeLa and 293T whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 99% Tris buffered saline, 0.1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab176809 was affinity purified using an epitope specific to WDR42A immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-5 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 67 kDa.

Target

Images

  • All lanes : Anti-WDR42A antibody (ab176809) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique

    Predicted band size : 67 kDa


    Exposure time : 3 seconds
  • Detection of WDR42A in immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176809 at 3 µg/mg lysate for IP (Lane 1) and at 0.4 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab176809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up