Overview

  • Product name
  • Description
    Rabbit polyclonal to WDR5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human WDR5 aa 1-334.
    Sequence:

    MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSS VKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDT ASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLK TYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH TDVVISTACHPTENIIASAALENDKTIKLWKSDC


    Database link: P61964

  • Positive control
    • 293T, 22RV-1, BT474 and HeLa cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab187178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 37 kDa.

Target

  • Function
    Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation.
  • Sequence similarities
    Belongs to the WD repeat WDR5/wds family.
    Contains 7 WD repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2410008O07Rik antibody
    • AA408785 antibody
    • AA960360 antibody
    • BIG 3 antibody
    • Big antibody
    • BIG3 antibody
    • BMP2 induced 3 kb gene protein antibody
    • BMP2 induced gene, 3-KB antibody
    • BMP2-induced 3-kb gene protein antibody
    • MGC114572 antibody
    • OTTHUMP00000162494 antibody
    • SWD 3 antibody
    • SWD3 antibody
    • SWD3 Set1c WD40 repeat protein homolog antibody
    • WD repeat containing protein 5 antibody
    • WD repeat domain 5 antibody
    • WD repeat protein 5 antibody
    • WD repeat-containing protein 5 antibody
    • WD repeat-containing protein BIG-3 antibody
    • WDR 5 antibody
    • Wdr5 antibody
    • WDR5_HUMAN antibody
    see all

Images

  • All lanes : Anti-WDR5 antibody (ab187178) at 1/500 dilution

    Lane 1 : 293T cell extract
    Lane 2 : 22RV-1 cell extract
    Lane 3 : BT474 cell extract
    Lane 4 : HeLa cell extract

    Predicted band size: 37 kDa

References

ab187178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up