Overview

  • Product nameAnti-WDR9 antibody
    See all WDR9 primary antibodies
  • Description
    Rabbit polyclonal to WDR9
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 2-51 (

    AEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKR

    ) of Human WDR9 (NP_001007247)

  • Positive control
    • PANC1 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab94916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be a transcriptional activator. May be involved in chromatin remodeling.
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesContains 2 bromo domains.
    Contains 8 WD repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Bromodomain and WD repeat domain containing protein 1 antibody
    • Bromodomain and WD repeat-containing protein 1 antibody
    • Brwd1 antibody
    • BRWD1_HUMAN antibody
    • C21orf107 antibody
    • cAMP response element binding and beta tranducin family antibody
    • FLJ11315 antibody
    • N143 antibody
    • Transcriptional unit N143 antibody
    • WD repeat protein antibody
    • WD repeat-containing protein 9 antibody
    • WDR9 antibody
    see all

Anti-WDR9 antibody images

  • Anti-WDR9 antibody (ab94916) at 1 µg/ml + PANC1 cell lysate at 10 µg with 5% skim milk / PBS buffer
    Gel concentration: 10-20%

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 13 kDa

References for Anti-WDR9 antibody (ab94916)

ab94916 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"