Overview

  • Product name
  • Description
    Rabbit polyclonal to WFS1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human WFS1 aa 76-282. BC030130.
    Sequence:

    GTGPTKGDMEIPFEEVLERAKAGDPKAQTEVGKHYLQLAGDTDEELNSCT AVDWLVLAAKQGRREAVKLLRRCLADRRGITSENEREVRQLSSETDLERA VRKAALVMYWKLNPKKKKQVAVAELLENVGQVNEHDGGAQPGPVPKSLQK QRRMLERLVSSESKNYIALDDFVEITKKYAKGVIPSSLFLQDDEDDDELA GKSPEDL


    Database link: O76024

  • Positive control
    • Human fetal heart and Human fetal muscle lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Detects a band of approximately 100 kDa (predicted molecular weight: 100 kDa).

Target

  • Relevance
    WFS1 is a novel component of Wolfram syndrome, a rare form of juvenile diabetes. WFS1 plays an important role in maintaining homeostasis of the endoplasmic reticulum (ER) in the pancreas. It is normally up-regulated during insulin secretion, whereas inactivation of the protein can cause ER stress. Chronic ER stress is a major involvement in Wolfram syndrome.
  • Cellular localization
    Endoplasmic reticulum; endoplasmic reticulum membrane; multipass membrane protein
  • Database links
  • Alternative names
    • CTRCT41 antibody
    • DFNA14 antibody
    • DFNA38 antibody
    • DFNA6 antibody
    • DIDMOAD antibody
    • WFRS antibody
    • WFS antibody
    • WFSL antibody
    • Wolfram syndrome 1 (wolframin) antibody
    • Wolfram syndrome antibody
    • WOLFRAMIN antibody
    • wolframin ER transmembrane glycoprotein antibody
    see all

Images

  • All lanes : Anti-WFS1 antibody (ab176909) at 1/500 dilution

    Lane 1 : Human fetal heart lysate
    Lane 2 : Human fetal muscle lysate


    Predicted band size : 100 kDa

References

ab176909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up