Anti-Wilms Tumor Protein antibody (ab180840)
Key features and details
- Rabbit polyclonal to Wilms Tumor Protein
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-Wilms Tumor Protein antibody
See all Wilms Tumor Protein primary antibodies -
Description
Rabbit polyclonal to Wilms Tumor Protein -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Pig -
Immunogen
Recombinant full length protein corresponding to Human Wilms Tumor Protein aa 1-302.
Sequence:MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYS VPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLG ATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVF RGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHS RKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSR SDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQL AL
Database link: P19544-6 -
Positive control
- WB: Human kidney and rat kidney tissue lysates. A549 and MCF7 cell lysates IHC-P: Human lung, human kidney and rat testis tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180840 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000.
|
|
IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
ICC/IF |
Use at an assay dependent concentration.
|
Notes |
---|
WB
1/500 - 1/2000. |
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
ICC/IF
Use at an assay dependent concentration. |
Target
-
Function
Transcription factor that plays an important role in cellular development and cell survival. Regulates the expression of numerous target genes, including EPO. Plays an essential role for development of the urogenital system. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'. It has a tumor suppressor as well as an oncogenic role in tumor formation. Function may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA. -
Tissue specificity
Expressed in the kidney and a subset of hematopoietic cells. -
Involvement in disease
Defects in WT1 are the cause of Frasier syndrome (FS) [MIM:136680]. FS is characterized by a slowly progressing nephropathy leading to renal failure in adolescence or early adulthood, male pseudohermaphroditism, and no Wilms tumor. As for histological findings of the kidneys, focal glomerular sclerosis is often observed. There is phenotypic overlap with Denys-Drash syndrome. Inheritance is autosomal dominant.
Defects in WT1 are the cause of Wilms tumor 1 (WT1) [MIM:194070]. WT is an embryonal malignancy of the kidney that affects approximately 1 in 10'000 infants and young children. It occurs both in sporadic and hereditary forms.
Defects in WT1 are the cause of Denys-Drash syndrome (DDS) [MIM:194080]. DDS is a typical nephropathy characterized by diffuse mesangial sclerosis, genital abnormalities, and/or Wilms tumor. There is phenotypic overlap with WAGR syndrome and Frasier syndrome. Inheritance is autosomal dominant, but most cases are sporadic.
Defects in WT1 are the cause of nephrotic syndrome type 4 (NPHS4) [MIM:256370]. A renal disease characterized clinically by proteinuria, hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure. Most patients with NPHS4 show diffuse mesangial sclerosis on renal biopsy, which is a pathologic entity characterized by mesangial matrix expansion with no mesangial hypercellularity, hypertrophy of the podocytes, vacuolized podocytes, thickened basement membranes, and diminished patency of the capillary lumen.
Defects in WT1 are a cause of Meacham syndrome (MEACHS) [MIM:608978]. Meacham syndrome is a rare sporadically occurring multiple malformation syndrome characterized by male pseudohermaphroditism with abnormal internal female genitalia comprising a uterus and double or septate vagina, complex congenital heart defect and diaphragmatic abnormalities.
Note=A chromosomal aberration involving WT1 may be a cause of desmoplastic small round cell tumor (DSRCT). Translocation t(11;22)(p13;q12) with EWSR1. -
Sequence similarities
Belongs to the EGR C2H2-type zinc-finger protein family.
Contains 4 C2H2-type zinc fingers. -
Cellular localization
Nucleus. Cytoplasm. Shuttles between nucleus and cytoplasm; Nucleus > nucleoplasm and Nucleus speckle. - Information by UniProt
-
Database links
- Entrez Gene: 7490 Human
- Entrez Gene: 22431 Mouse
- Entrez Gene: 397338 Pig
- Omim: 607102 Human
- SwissProt: P19544 Human
- SwissProt: P22561 Mouse
- SwissProt: O62651 Pig
- Unigene: 591980 Human
-
Alternative names
- WIT 2 antibody
- WT 1 antibody
- AWT1 antibody
see all
Images
-
Immunohistochemical analysis of paraffin-embedded human liver injury using WT1 antibody (ab180840) at dilution of 1/100.
-
All lanes : Anti-Wilms Tumor Protein antibody (ab180840) at 1/500 dilution
Lane 1 : A549 cell lysate
Lane 2 : MCF7 cell lysate
Lane 3 : Mouse heart tissue lysate
Lane 4 : Mouse testis tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution
Observed band size: 49 kDa why is the actual band size different from the predicted?Blocking buffer: 3% nonfat dry milk in TBST. -
Immunocytochemistry/ Immunofluorescence analysis of HeLa cells using WT1 antibody (ab180840). Blue: DAPI for nuclear staining.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (11)
ab180840 has been referenced in 11 publications.
- He J et al. The miR-203a Regulatory Network Affects the Proliferation of Chronic Myeloid Leukemia K562 Cells. Front Cell Dev Biol 9:616711 (2021). PubMed: 33659248
- Lee HS et al. Lipotoxicity dysregulates the immunoproteasome in podocytes and kidneys in type 2 diabetes. Am J Physiol Renal Physiol 320:F548-F558 (2021). PubMed: 33586497
- Liu B et al. Inhibition of Notch Signaling Promotes the Differentiation of Epicardial Progenitor Cells into Adipocytes. Stem Cells Int 2021:8859071 (2021). PubMed: 33897781
- Li B et al. Resveratrol alleviates obesity-associated podocyte injury in ovariectomized obese rats. Exp Ther Med 19:123-130 (2020). PubMed: 31853281
- Di Tu Q et al. Curcumin Improves the Renal Autophagy in Rat Experimental Membranous Nephropathy via Regulating the PI3K/AKT/mTOR and Nrf2/HO-1 Signaling Pathways. Biomed Res Int 2020:7069052 (2020). PubMed: 33204708