Overview

  • Product nameAnti-WIPI1 antibody
    See all WIPI1 primary antibodies
  • Description
    Rabbit polyclonal to WIPI1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (

    AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN

    ) of Human WIPI1 (NP_060453).

  • Positive control
    • COLO205 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab99199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay play a role in autophagy. May regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway.
  • Tissue specificityUbiquitously expressed. Highly expressed in skeletal muscle, heart, testis, pancreas and placenta. Highly expressed in G361, Sk-mel-28, Sk-mel-13, WM852 and WM451 cells. Up-regulated in a variety of tumor tissues.
  • Sequence similaritiesBelongs to the WD repeat SVP1 family.
    Contains 3 WD repeats.
  • Cellular localizationGolgi apparatus > trans-Golgi network. Endosome. Cytoplasmic vesicle > clathrin-coated vesicle. Trans elements of the Golgi and peripheral endosomes. Dynamically cycles through these compartments and is susceptible to conditions that modulate membrane flux. Enriched in clathrin-coated vesicles.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATG 18 antibody
    • ATG18 antibody
    • Atg18 protein homolog antibody
    • ATG18A antibody
    • FLJ10055 antibody
    • WD repeat domain phosphoinositide interacting 1 antibody
    • WD repeat domain phosphoinositide interacting protein 1 antibody
    • WD repeat domain phosphoinositide-interacting protein 1 antibody
    • WD40 repeat protein interacting with phosphoinositides of 49 kDa antibody
    • WD40 repeat protein interacting with phosphoInositides of 49kDa antibody
    • WIPI 1 alpha antibody
    • WIPI 1 antibody
    • WIPI 49 antibody
    • WIPI 49 kDa antibody
    • WIPI-1 antibody
    • wipi1 antibody
    • WIPI1_HUMAN antibody
    • WIPI49 antibody
    see all

Anti-WIPI1 antibody images

  • Anti-WIPI1 antibody (ab99199) at 1 µg/ml + COLO205 cell lysate at 10 µg

    Predicted band size : 49 kDa

References for Anti-WIPI1 antibody (ab99199)

ab99199 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"