Overview

  • Product name
  • Description
    Rabbit polyclonal to WNK3
  • Host species
    Rabbit
  • Specificity
    This antibody detects endogenous levels of WNK3 protein.
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human WNK3 aa 1-1800.
    Sequence:

    MATDSGDPASTEDSEKPDGISFENRVPQVAATLTVEARLKEKNSTFSASG ETVERKRFFRKSVEMTEDDKVAESSPKDERIKAAMNIPRVDKLPSNVLRG GQEVKYEQCSKSTSEISKDCFKEKNEKEMEEEAEMKAVATSPSGRFLKFD IELGRGAFKTVYKGLDTETWVEVAWCELQDRKLTKAEQQRFKEEAEMLKG LQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLKRFKVMKPKVL RSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATL MRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSE CQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIRDLL NHAFFAEDTGLRVELAEEDDCSNSSLALRLWVEDPKKLKGKHKDNEAIEF SFNLETDTPEEVAYEMVKSGFFHESDSKAVAKSIRDRVTPIKKTREKKPA GCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQ LLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMV SNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQST VLPVHVLGPTVVSQPQVSPLTVQKVPQIKPVSQPVGAEQQAALLKPDLVR SLNQDVATTKENVSSPDNPSGNGKQDRIKQRRASCPRPEKGTKFQLTVLQ VSTSGDNMVECQLETHNNKMVTFKFDVDGDAPEDIADYMVEDNFVLESEK EKFVEELRAIVGQAQEILHVHFATERATGVDSITVDSNSSQTGSSEQVQI NSTSTQTSNESAPQSSPVGRWRFCINQTIRNRETQSPPSLQHSMSAVPGR HPLPSPKNTSNKEISRDTLLTIENNPCHRALFTSKSEHKDVVDGKISECA SVETKQPAILYQVEDNRQIMAPVTNSSSYSTTSVRAVPAECEGLTKQASI FIPVYPCHQTASQADALMSHPGESTQTSGNSLTTLAFDQKPQTLSVQQPA MDAEFISQEGETTVNTEASSPKTVIPTQTPGLEPTTLQPTTVLESDGERP PKLEFADNRIKTLDEKLRNLLYQEHSISSIYPESQKDTQSIDSPFSSSAE DTLSCPVTEVIAISHCGIKDSPVQSPNFQQTGSKLLSNVAASQPANISVF KRDLNVITSVPSELCLHEMSSDASLPGDPEAYPAAVSSGGAIHLQTGGGY FGLSFTCPSLKNPISKKSWTRKLKSWAYRLRQSTSFFKRSKVRQVETEEM RSAIAPDPIPLTRESTADTRALNRCKAMSGSFQRGRFQVITIPQQQSAKM TSFGIEHISVFSETNHSSEEAFIKTAKSQLVEIEPATQNPKTSFSYEKLQ ALQETCKENKGVPKQGDNFLSFSAACETDVSSVTPEKEFEETSATGSSMQ SGSELLLKEREILTAGKQPSSDSEFSASLAGSGKSVAKTGPESNQCLPHH EEQAYAQTQSSLFYSPSSPMSSDDESEIEDEDLKVELQRLREKHIQEVVN LQTQQNKELQELYERLRSIKDSKTQSTEIPLPPASPRRPRSFKSKLRSRP QSLTHVDNGIVATGKSCLINELENPLCVESNAASCQQSPASKKGMFTDDL HKLVDDWTKEAVGNSLIKPSLNQLKQSQHKLETENWNKVSENTPSTMGYT STWISSLSQIRGAVPTSLPQGLSLPSFPGPLSSYGMPHVCQYNAVAGAGY PVQWVGISGTTQQSVVIPAQSGGPFQPGMNMQAFPTSSVQNPATIPPGPK


    Database link: Q9BYP7

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192378 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 198 kDa.

Target

  • Tissue specificity
    Expressed in brain, lung, kidney, liver and pancreas, and in fetal tissues including placenta, fetal brain, lung and kidney. Very low levels of expression were also detected in fetal heart, thymus, liver and spleen.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • KIAA1566 antibody
    • PRKWNK 3 antibody
    • PRKWNK3 antibody
    • Protein kinase lysine deficient 3 antibody
    • Protein kinase lysine-deficient 3 antibody
    • Protein kinase with no lysine 3 antibody
    • Serine/threonine protein kinase WNK3 antibody
    • Serine/threonine-protein kinase WNK3 antibody
    • WNK 3 antibody
    • WNK lysine deficient protein kinase 3 antibody
    • Wnk3 antibody
    • WNK3_HUMAN antibody
    see all

References

ab192378 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192378.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up