Overview

  • Product name
  • Description
    Rabbit polyclonal to WSB2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human WSB2 aa 254-317.
    Sequence:

    LVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSP EGLYLATVADDRLL


    Database link: Q9NYS7

  • Positive control
    • Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab187987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    WSB2 is a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquitin protein ligases.
  • Database links
  • Alternative names
    • AA673511 antibody
    • CS box containing WD protein antibody
    • MGC10210 antibody
    • MGC93822 antibody
    • OTTMUSP00000031379 antibody
    • SBA2 antibody
    • SOCS box containing WD protein SWiP 2 antibody
    • Swip2 antibody
    • WD 40 repeat containing protein with a SOCS box 2 antibody
    • WD repeat and SOCS box containing 2 antibody
    • WD repeat and SOCS box containing protein 2 antibody
    • WD SOCS box protein 2 antibody
    • WSB 2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling WSB2 with ab187987 at 1/50 dilution.

References

ab187987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up