Overview

  • Product nameAnti-XAB2 antibody
    See all XAB2 primary antibodies
  • Description
    Rabbit polyclonal to XAB2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 36-85 (

    KCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKHR

    ) of Human XAB2 (NP_064581).

  • Positive control
    • PANC-1 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab90127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 100 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionInvolved in transcription-coupled repair (TCR), transcription and pre-mRNA splicing.
  • Sequence similaritiesBelongs to the crooked-neck family.
    Contains 14 HAT repeats.
  • Cellular localizationNucleus. Detected in the splicing complex carrying pre-mRNA.
  • Information by UniProt
  • Database links
  • Alternative names
    • 0610041O14Rik antibody
    • adapter protein ATH 55 antibody
    • Adapter protein ATH-55 antibody
    • Ath55 antibody
    • AV025587 antibody
    • Crn related protein kim1 antibody
    • crn-related protein kim1 antibody
    • DKFZp762C1015 antibody
    • HCNP antibody
    • HCNP protein antibody
    • HCRN antibody
    • KIAA1177 antibody
    • NTC90 antibody
    • PP3898 antibody
    • Pre-mRNA-splicing factor SYF1 antibody
    • Protein HCNP antibody
    • RNA splicing factor antibody
    • SYF1 antibody
    • SYF1 homolog antibody
    • SYF1 homolog, RNA splicing factor antibody
    • SYF1 pre mRNA splicing factor antibody
    • SYF1_HUMAN antibody
    • Xab2 antibody
    • XPA binding protein 2 antibody
    • XPA-binding protein 2 antibody
    see all

Anti-XAB2 antibody images

  • Anti-XAB2 antibody (ab90127) at 1 µg/ml (5% skim milk / PBS buffer) + PANC-1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 100 kDa

References for Anti-XAB2 antibody (ab90127)

ab90127 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"