Overview

  • Product name
    Anti-xCT antibody
    See all xCT primary antibodies
  • Description
    Rabbit polyclonal to xCT
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, Flow Cyt, IHC-P, ICC/IF, IHC-FoFrmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human xCT aa 1-50 (N terminal). The exact sequence is proprietary.
    Sequence:

    MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGV


    Database link: Q9UPY5

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control
    • WB: Human and mouse stomach tissue lysate; Human Stomach Cancer tissue lysate; HepG2 cell lysate IHC: Small intestine ICC/IF: HepG2 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab37185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 55 kDa.

xCT forms heterodimer with 4F2Hc protein hence reducing conditions should be used in WB. It exists as multi-pass membrane protein therefore we recommend heating the lysates for 15-20 minutes at 60-70C.
Flow Cyt Use a concentration of 2 - 3 µg/ml.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.
IHC-P Use a concentration of 5 µg/ml.
ICC/IF 1/100 - 1/1000.
IHC-FoFr Use at an assay dependent concentration. PubMed: 21639880

Target

  • Function
    Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.
  • Sequence similarities
    Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
    • Alternative names
      • Amino acid transport system xc xCT antibody antibody
      • Amino acid transport system xc- antibody
      • Calcium channel blocker resistance protein CCBR1 antibody
      • Calcium channel blocker resistance protein CCBR1 antibody antibody
      • CCBR1 antibody
      • Cysteine/glutamate transporter antibody antibody
      • Cystine/glutamate transporter antibody
      • OTTHUMP00000164578 antibody
      • SLC7A11 antibody
      • Solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 antibody
      • solute carrier family 7 antibody
      • Solute carrier family 7 member 11 antibody
      • Solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 antibody
      • SYSTEM Xc(-) TRANSPORTER-RELATED PROTEIN antibody
      • xCT antibody
      • XCT_HUMAN antibody
      see all

    Images

    • Western blot - Anti-xCT antibody (ab37185)
      Western blot - Anti-xCT antibody (ab37185)
      All lanes : Anti-xCT antibody (ab37185) at 0.5 µg/ml

      Lane 1 : Total human stomach lysate.
      Lane 2 : Total mouse stomach lysate.

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 55 kDa
      Observed band size: 55 kDa


      Exposure time: 1 minute
    • Immunocytochemistry/ Immunofluorescence - Anti-xCT antibody (ab37185)
      Immunocytochemistry/ Immunofluorescence - Anti-xCT antibody (ab37185)

      Imunocytochemistry/ Immunofluorescence analysis of HepG2 cells labeling xCT with ab37185 followed by Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red) respectively. 

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-xCT antibody (ab37185)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-xCT antibody (ab37185)

      Immunohistochemical analysis of small intestine labeling xCT with ab37185. Staining is observed in the absorptive epithelia of small intestinal villi. 

    • Immunohistochemistry (PFA perfusion fixed frozen sections) - Anti-xCT antibody (ab37185)
      Immunohistochemistry (PFA perfusion fixed frozen sections) - Anti-xCT antibody (ab37185)Image from Olatz Pampliega et al J Neuroinflammation. 2011; 8: 63. Figure 5. doi: 10.1186/1742-2094-8-63

      PFA perfusion fixed frozen sections of spinal cord of control (left) and MS patients (right) stained for xCT using ab37185 at 5 µg/ml.

    • Western blot - Anti-xCT antibody (ab37185)
      Western blot - Anti-xCT antibody (ab37185)
      All lanes : Anti-xCT antibody (ab37185)

      Lane 1 : Human Stomach Cancer tissue lysate
      Lane 2 : HepG2 cell lysate

      Lysates/proteins at 0.5 mg/ml per lane.

      Predicted band size: 55 kDa



      This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa.

    References

    This product has been referenced in:
    • Hagiwara M  et al. Variant isoforms of CD44 involves acquisition of chemoresistance to cisplatin and has potential as a novel indicator for identifying a cisplatin-resistant population in urothelial cancer. BMC Cancer 18:113 (2018). WB ; Human . Read more (PubMed: 29385995) »
    • Krzyzanowska W  et al. Ceftriaxone- and N-acetylcysteine-induced brain tolerance to ischemia: Influence on glutamate levels in focal cerebral ischemia. PLoS One 12:e0186243 (2017). IHC-P ; Rat . Read more (PubMed: 29045497) »

    See all 22 Publications for this product

    Publishing research using ab37185? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Submit a review Submit a question

    10 reviews or Q&A

    10
    Votes: Highest First

    Western blot abreview for Anti-xCT antibody

     Average
    Abreviews
    Application
    Western blot
    Sample
    Human Cell lysate - whole cell (head and neck cancer)
    Gel Running Conditions
    Non-reduced Denaturing (10% gel)
    Loading amount
    20 µg
    Treatment
    drug 48h
    Specification
    head and neck cancer
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More
    abreview image
    Username

    Abcam user community

    Verified customer

    Submitted Oct 21 2015

    IHC - Wholemount abreview for Anti-xCT antibody

     Excellent
    Abreviews
    Application
    IHC - Wholemount
    Sample
    Human Tissue (head and neck cancer)
    Specification
    head and neck cancer
    Read More
    abreview image
    Username

    Miss. Jin Young Park

    Verified customer

    Submitted Oct 19 2015



    You ask a good question. Actually, A549 cells have been shown to have high expression of xCT, so that is my positive control. After doing a bit of research on the matter, I think that the 105 kDa band that I am detecting is probably the hete...

    Read More

    Thanks so muchfor your reply and best of luck with your upcoming experiments. If you have any further questions please do not hesitate to contact me.

    Inquiry: Hello, I have made two attempts to use your anti-xCT antibody to detect xCT in cell lysates and both blots have resulted in numerous bands, none at the predicted MW of 55 kDa. I have attached an image of my most recent blot to this message. My...

    Read More

    Thanks for submitting your enquiry. I am sorry to hear this antibody is giving you trouble.

    I was just wondering what positive control samples you have used?

    Thanks in advance for the additional information.

    Hi There,

     

    I wrote you emails to explain my concern of using your xCT antibody to do flow cytometry and ask for your help. But I did not receive any response after I provided you with my experiment details, which makes me very up...

    Read More

    Thank you for contacting us and making us aware of this. We have been transitioning to a new email system and it may be that the response which I had sent on Mon 16 Apr 12 13:26GMT was somehow caught up or perhaps it went directly to your spam or ju...

    Read More

    I used human breast cancer cell line MCF-7 cells. Negative control: cells only, secondary anti rabbit IgG fitc only. No positive control. I used up the antibody for real experiments.. FITC secondary antibody was newly ordered, it is working very wel...

    Read More

    Thank you for your response and for the additional details which you have provided.

    You are correct as this antibody will only recognize the intracellular epitope of xCT. As such you would need to permeablize your cells to allow entry of the...

    Read More

    Hi There,

    Our lab recently purchased xCT antibody ab37185 for flow cytometry study. I want to measure xCT cell surface expression. So I first incubated my cells with ab37185 (10ul per sample) for 1hr and washed for 2˜3 times with PBS then incu...

    Read More

    Thank you for contacting Abcam, I am sorry to hear that you have been experiencing difficulties using this product in flow.

    Would you be able to provide me the specific details of your experiments? Useful information would include but not be...

    Read More

    I'm wondering if you could send me a aliquot of your xCT antibody ab37185.
    Indeed, I would like to test it on fresh samplesthat will beready at the end of the monthand, at the moment, we are not able to make any order (indeed we are changing oursy...

    Read More

    Thank you for contacting Abcam.

    We are unable to send you any free/trail sizes of our antibodies. When your ordering system is reorganized at the end of the month, you will be able to order the antibody and if it is in stock then it will be s...

    Read More

    Multiple bands in addition to specific band,using human primary blood samples.

    Thank you for your call today and for letting us know about the trouble with ab37185. As we discussed, please let me know if the suggestions that we discussed don't improve the results, and I will be happy to help you further. If you have any questions...

    Read More

    Called because he did not receive the email back from technical support when he sent in the questionnaire.

    Thank you for your enquiry. As discussed on the phone, here is the email that was sent in response to your questionnaire from Kate Hayes on December 1st, 2006. Reply from Abcam to your enquiry regarding ab37185 Dear Ilangovan, In response to ...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up