Overview

  • Product nameAnti-xCT antibody
    See all xCT primary antibodies
  • Description
    Rabbit polyclonal to xCT
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215-264 (

    KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK

    ) of Human xCT (NP_055146).

  • Positive control
    • THP-1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionSodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.
  • Sequence similaritiesBelongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Amino acid transport system xc xCT antibody antibody
    • Amino acid transport system xc- antibody
    • Calcium channel blocker resistance protein CCBR1 antibody
    • Calcium channel blocker resistance protein CCBR1 antibody antibody
    • CCBR1 antibody
    • Cysteine/glutamate transporter antibody antibody
    • Cystine/glutamate transporter antibody
    • OTTHUMP00000164578 antibody
    • SLC7A11 antibody
    • Solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 antibody
    • solute carrier family 7 antibody
    • Solute carrier family 7 member 11 antibody
    • Solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 antibody
    • SYSTEM Xc(-) TRANSPORTER-RELATED PROTEIN antibody
    • xCT antibody
    • XCT_HUMAN antibody
    see all

Anti-xCT antibody images

  • Anti-xCT antibody (ab99059) at 1 µg/ml + THP-1 cell lysate at 10 µg

    Predicted band size : 55 kDa

References for Anti-xCT antibody (ab99059)

ab99059 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"