Overview

  • Product name
  • Description
    Rabbit polyclonal to XPA
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human XPA aa 1-273.
    Sequence:

    MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSA TAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEF DYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLL KDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEAL EEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEE NLEDDMYRKTCTMCGHELTYEKM


    Database link: P23025

  • Positive control
    • HEK­293 cell line extract.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 31 kDa.

Target

  • Function
    Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation.
  • Tissue specificity
    Expressed in various cell lines and in skin fibroblasts.
  • Involvement in disease
    Defects in XPA are a cause of xeroderma pigmentosum complementation group A (XP-A) [MIM:278700]; also known as xeroderma pigmentosum type 1 (XP1). XP-A is a rare human autosomal recessive disease characterized by solar sensitivity, high predisposition for developing cancers on areas exposed to sunlight and, in some cases, neurological abnormalities. Group A patients show the most severe skin symptoms and progressive neurological disorders.
  • Sequence similarities
    Belongs to the XPA family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Ubiquitinated by HERC2 leading to degradation by the proteasome.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DNA repair protein complementing XP A cells antibody
    • DNA repair protein complementing XP-A cells antibody
    • DNA repair protein complementing XPA cells antibody
    • Excision repair controlling antibody
    • Xeroderma pigmentosum 1 antibody
    • Xeroderma pigmentosum complementation group A antibody
    • Xeroderma pigmentosum group A complementing protein antibody
    • Xeroderma pigmentosum group A-complementing protein antibody
    • XP 1 antibody
    • XP1 antibody
    • xpa antibody
    • XPA_HUMAN antibody
    • Xpac antibody
    see all

Images

  • Immunofluorescence analysis of GFP-RNF168 transgenic U2OS cell using ab180618 Green: GFP-RNF168 fusion protein expression for DNA damage marker. Blue: DAPI for nuclear staining. RNF168(GFP) can be used to mark cells damaged by UV-A laser for they always gather around DNA damage region.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat brain tissue labelling XPA with ab180618 at 1/200. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung cancer tissue labelling XPA with ab180618 at 1/200. Magnification: 200x.
  • Anti-XPA antibody (ab180618) at 1/500 dilution + HEK­293 cell line extract

    Predicted band size : 31 kDa

References

ab180618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up