Overview

  • Product name
  • Description
    Mouse polyclonal to XPG
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human XPG aa 1-1186. NCBI: NP_000114.2
    Sequence:

    MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSI ENPHLLTLFHRLCKLLFFRIRPIFVFDGDAPLLKKQTLVKRRQRKDLASS DSRKTTEKLLKTFLKRQAIKTAFRSKRDEALPSLTQVRRENDLYVLPPLQ EEEKHSSEEEDEKEWQERMNQKQALQEEFFHNPQAIDIESEDFSSLPPEV KHEILTDMKEFTKRRRTLFEAMPEESDDFSQYQLKGLLKKNYLNQHIEHV QKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTV AEVDSESLPSSSKMHGMSFDVKSSPCEKLKTEKEPDATPPSPRTLLAMQA ALLGSSSEEELESENRRQARGRNAPAAVDEGSISPRTLSAIKRALDDDED VKVCAGDDVQTGGPGAEEMRINSSTENSDEGLKVRDGKGIPFTATLASSS VNSAEEHVASTNEGREPTDSVPKEQMSLVHVGTEAFPISDESMIKDRKDR LPLESAVVRHSDAPGLPNGRELTPASPTCTNSVSKNETHAEVLEQQNELC PYESKFDSSLLSSDDETKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNV ENVVSFNAKEHENFLETIQEQQTTESAGQDLISIPKAVEPMEIDSEESES DGSFIEVQSVISDEELQAEFPETSKPPSEQGEEELVGTREGEAPAESESL LRDNSERDDVDGEPQEAEKDAEDSLHEWQDINLEELETLESNLLAQQNSL KAQKQQQERIAATVTGQMFLESQELLRLFGIPYIQAPMEAEAQCAILDLT DQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDFHNQLGLDRNK LINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQ KNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLW GKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLA QQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDK AKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGS SSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSD SDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT


    Database link: P28715

  • Positive control
    • XPG transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab171808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 130.46 kDa.

Target

  • Function
    Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too.
  • Involvement in disease
    Defects in ERCC5 are the cause of xeroderma pigmentosum complementation group G (XP-G) [MIM:278780]; also known as xeroderma pigmentosum VII (XP7). Xeroderma pigmentosum is an autosomal recessive pigmentary skin disorder characterized by solar hypersensitivity of the skin, high predisposition for developing cancers on areas exposed to sunlight and, in some cases, neurological abnormalities. Some XP-G patients present features of Cockayne syndrome, including dwarfism, sensorineural deafness, microcephaly, mental retardation, pigmentary retinopathy, ataxia, decreased nerve conduction velocities.
  • Sequence similarities
    Belongs to the XPG/RAD2 endonuclease family. XPG subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • COFS 3 antibody
    • COFS3 antibody
    • DNA excision repair protein ERCC 5 antibody
    • DNA excision repair protein ERCC-5 antibody
    • DNA excision repair protein ERCC5 antibody
    • DNA repair protein complementing XP G cells antibody
    • DNA repair protein complementing XP-G cells antibody
    • DNA repair protein complementing XPG cells antibody
    • ERCC 5 antibody
    • ERCC5 antibody
    • ERCC5_HUMAN antibody
    • ERCM 2 antibody
    • ERCM2 antibody
    • Excision repair cross complementation group 5 antibody
    • Excision Repair Cross Complementing Rodent Repair Deficiency antibody
    • Excision repair cross complementing rodent repair deficiency complementation group 5 antibody
    • Excision repair protein antibody
    • OTTHUMP00000064902 antibody
    • UVDR antibody
    • Xeroderma Pigmentosum Complementation Group G antibody
    • Xeroderma pigmentosum complementation group G protein antibody
    • Xeroderma pigmentosum group G complementing protein antibody
    • Xeroderma pigmentosum group G-complementing protein antibody
    • XPG antibody
    • XPG complementing protein antibody
    • XPGC antibody
    see all

Images

  • All lanes : Anti-XPG antibody (ab171808) at 1/500 dilution

    Lane 1 : XPG transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat Anti-Mouse IgG at 1/2500 dilution

    Predicted band size : 130.46 kDa

References

ab171808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up