Overview

  • Product name
    Anti-XPG antibody - N-terminal
    See all XPG primary antibodies
  • Description
    Rabbit polyclonal to XPG - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human XPG aa 258-307 (N terminal). The exact sequence is proprietary.
    Sequence:

    HSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSES


    Database link: P28715

  • Positive control
    • Ovary tumour tissue lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 2% Sucrose, 98% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 133 kDa.

Target

  • Function
    Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too.
  • Involvement in disease
    Defects in ERCC5 are the cause of xeroderma pigmentosum complementation group G (XP-G) [MIM:278780]; also known as xeroderma pigmentosum VII (XP7). Xeroderma pigmentosum is an autosomal recessive pigmentary skin disorder characterized by solar hypersensitivity of the skin, high predisposition for developing cancers on areas exposed to sunlight and, in some cases, neurological abnormalities. Some XP-G patients present features of Cockayne syndrome, including dwarfism, sensorineural deafness, microcephaly, mental retardation, pigmentary retinopathy, ataxia, decreased nerve conduction velocities.
  • Sequence similarities
    Belongs to the XPG/RAD2 endonuclease family. XPG subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • COFS 3 antibody
    • COFS3 antibody
    • DNA excision repair protein ERCC 5 antibody
    • DNA excision repair protein ERCC-5 antibody
    • DNA excision repair protein ERCC5 antibody
    • DNA repair protein complementing XP G cells antibody
    • DNA repair protein complementing XP-G cells antibody
    • DNA repair protein complementing XPG cells antibody
    • ERCC 5 antibody
    • ERCC5 antibody
    • ERCC5_HUMAN antibody
    • ERCM 2 antibody
    • ERCM2 antibody
    • Excision repair cross complementation group 5 antibody
    • Excision Repair Cross Complementing Rodent Repair Deficiency antibody
    • Excision repair cross complementing rodent repair deficiency complementation group 5 antibody
    • Excision repair protein antibody
    • OTTHUMP00000064902 antibody
    • UVDR antibody
    • Xeroderma Pigmentosum Complementation Group G antibody
    • Xeroderma pigmentosum complementation group G protein antibody
    • Xeroderma pigmentosum group G complementing protein antibody
    • Xeroderma pigmentosum group G-complementing protein antibody
    • XPG antibody
    • XPG complementing protein antibody
    • XPGC antibody
    see all

Images

  • Anti-XPG antibody - N-terminal (ab182311) at 1 µg/ml + Human ovary tumour tissue lysate at 10 µg

    Predicted band size : 133 kDa

    Blocked with 5% milk.

References

ab182311 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up