Overview

  • Product name
  • Description
    Rabbit polyclonal to XRCC2
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human XRCC2 aa 1-280.
    Sequence:

    MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPE GTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRL SQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDS LSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQ KASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSS NQFSLVSRCLKSNSLKKHFFIIGESGVEFC


    Database link: O43543

  • Positive control
    • Extracts of HeLa, SH-SY5Y and SW480 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 32 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA.
  • Sequence similarities
    Belongs to the RecA family. RAD51 subfamily.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm, Cytoskeleton, Nucleus
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp781P0919 antibody
    • DNA repair protein XRCC2 antibody
    • X ray repair complementing defective repair in Chinese hamster cells 2 antibody
    • X ray repair cross complementing protein 2 antibody
    • X-ray repair cross-complementing protein 2 antibody
    • Xrcc2 antibody
    • XRCC2_HUMAN antibody
    see all

Images

  • All lanes : Anti-XRCC2 antibody (ab180752) at 1/500 dilution

    Lane 1 : Extracts of HeLa cell line
    Lane 2 : Extracts of SH-SY5Y cell line
    Lane 3 : Extracts of SW480 cell line


    Predicted band size : 32 kDa
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human thyroid cancer tissue labelling XRCC2 with ab180752 at a dilution of 1/50.
  • Immunocytochemistry/Immunofluorescence analysis of A549 cells labeling XRCC2 with ab180752 (shown in green) at a dilution of 1/50. Nuclear DNA was labelled with DAPI (shown in blue).
  • Immunocytochemistry/Immunofluorescence analysis of A549 cells labeling XRCC2 with ab180752 (shown in green) at a dilution of 1/50.
  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180752. Blue DAPI for nuclear staining.

References

ab180752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up