Overview

  • Product name
  • Description
    Rabbit polyclonal to YIF1A
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    antigen sequence corresponding to amino acids 240-269 (

    ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ

    ) of Human YIF1A.

  • Positive control
    • Human smooth muscle tissue; RT-4 and U-251 MG cell lysates; A-431 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab121455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function
    Possible role in transport between endoplasmic reticulum and Golgi.
  • Sequence similarities
    Belongs to the YIF1 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane. Cycles between the endoplasmic reticulum and the endoplasmic reticulum-Golgi intermediate compartment.
  • Information by UniProt
  • Database links
  • Alternative names
    • 54TM antibody
    • 54TMp antibody
    • FinGER7 antibody
    • Protein YIF1A antibody
    • Putative Rab5 interacting protein antibody
    • Putative transmembrane protein 54TMp antibody
    • YIF1 antibody
    • yif1a antibody
    • YIF1A_HUMAN antibody
    • YIF1P antibody
    • YIP1-interacting factor homolog A antibody
    • Yip1p interacting factor antibody
    see all

Images

  • ab121455, at 1/150 dilution, staining YIF1A in paraffin-embedded Human smooth muscle tissue by Immunohistochemistry.
  • All lanes : Anti-YIF1A antibody (ab121455) at 1/250 dilution

    Lane 1 : Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
    Lane 2 : RT-4 cell lysate
    Lane 3 : U-251 MG cell lysate
    Lane 4 : Human Plasma lysate
    Lane 5 : Human Liver lysate
    Lane 6 : Human Tonsil lysate
  • ab121455, at 4µg/ml, staining YIF1A (green) in A-431 cells by Immunofluorescence.

References

ab121455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up