Overview

  • Product nameAnti-YIF1A antibody
    See all YIF1A primary antibodies
  • Description
    Rabbit polyclonal to YIF1A
  • Tested applicationsSuitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    antigen sequence corresponding to amino acids 240-269 (

    ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ

    ) of Human YIF1A.

  • Positive control
    • Human smooth muscle tissue; RT-4 and U-251 MG cell lysates; A-431 cells

Properties

Applications

Our Abpromise guarantee covers the use of ab121455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • FunctionPossible role in transport between endoplasmic reticulum and Golgi.
  • Sequence similaritiesBelongs to the YIF1 family.
  • Cellular localizationEndoplasmic reticulum membrane. Golgi apparatus membrane. Cycles between the endoplasmic reticulum and the endoplasmic reticulum-Golgi intermediate compartment.
  • Information by UniProt
  • Database links
  • Alternative names
    • 54TM antibody
    • 54TMp antibody
    • FinGER7 antibody
    • Protein YIF1A antibody
    • Putative Rab5 interacting protein antibody
    • Putative transmembrane protein 54TMp antibody
    • YIF1 antibody
    • yif1a antibody
    • YIF1A_HUMAN antibody
    • YIF1P antibody
    • YIP1-interacting factor homolog A antibody
    • Yip1p interacting factor antibody
    see all

Anti-YIF1A antibody images

  • ab121455, at 1/150 dilution, staining YIF1A in paraffin-embedded Human smooth muscle tissue by Immunohistochemistry.
  • All lanes : Anti-YIF1A antibody (ab121455) at 1/250 dilution

    Lane 1 : Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
    Lane 2 : RT-4 cell lysate
    Lane 3 : U-251 MG cell lysate
    Lane 4 : Human Plasma lysate
    Lane 5 : Human Liver lysate
    Lane 6 : Human Tonsil lysate
  • ab121455, at 4µg/ml, staining YIF1A (green) in A-431 cells by Immunofluorescence.

References for Anti-YIF1A antibody (ab121455)

ab121455 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab121455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"