Overview

  • Product name
    Anti-YJEFN3 antibody
  • Description
    Rabbit polyclonal to YJEFN3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human YJEFN3 aa 231-294.
    Sequence:

    SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVR RKFALRLPGYTGTD


    Database link: A6XGL0

  • Positive control
    • Human lateral ventricle, Human ovary and Human liver cancer tissues.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May play a role in spermiogenesis and oogenesis.
  • Tissue specificity
    Expressed in theca cells in ovary and in Leydig cells in testis (at protein level). Also expressed in brain and mammary gland.
  • Sequence similarities
    Contains 1 YjeF N-terminal domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Apolipoprotein A1 binding protein antibody
    • FLJ44968 antibody
    • hYjeF_N3 antibody
    • hYjeF_N3-19p13.11 antibody
    • MGC138490 antibody
    • OTTHUMP00000221708 antibody
    • OTTHUMP00000221709 antibody
    • YjeF N terminal domain containing 3 antibody
    • YjeF N-terminal domain-containing protein 3 antibody
    • YjeF_N3 antibody
    • YJEFN3 antibody
    • YJEN3_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human liver cancer tissue labeling YJEFN3 with ab188482 at 1/20.

  • Immunohistochemical analysis of paraffin embedded Human ovary tissue labeling YJEFN3 with ab188482 at 1/20.

  • Immunohistochemical analysis of paraffin embedded Human lateral ventricle tissue labeling YJEFN3 with ab188482 at 1/20.

References

ab188482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up