Overview

  • Product name
  • Description
    Rabbit polyclonal to YTHDF1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human YTHDF1 aa 287-336 (internal sequence).
    Sequence:

    QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA

  • Positive control
    • HepG2 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab99080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-YTHDF1 antibody images

  • Anti-YTHDF1 antibody (ab99080) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 61 kDa
    Gel concentration 12%

References for Anti-YTHDF1 antibody (ab99080)

This product has been referenced in:
  • Tirumuru N  et al. N(6)-methyladenosine of HIV-1 RNA regulates viral infection and HIV-1 Gag protein expression. Elife 5:N/A (2016). WB ; Human . Read more (PubMed: 27371828) »
  • Lin S  et al. The m(6)A Methyltransferase METTL3 Promotes Translation in Human Cancer Cells. Mol Cell 62:335-45 (2016). WB ; Human . Read more (PubMed: 27117702) »

See all 3 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab99080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up