Anti-Z DNA binding protein antibody (ab32927)

Overview

  • Product name
    Anti-Z DNA binding protein antibody
    See all Z DNA binding protein primary antibodies
  • Description
    Rabbit polyclonal to Z DNA binding protein
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human Z DNA binding protein aa 144-193 (internal sequence).
    Sequence:

    LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMIC


    Database link: Q9H171

  • Positive control
    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab32927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/312500.
WB Use a concentration of 5 µg/ml. Detects a band of approximately 46 kDa (predicted molecular weight: 46 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May play a role in host defense against tumors and pathogens. Binds Z-DNA.
  • Tissue specificity
    Highly expressed in lymphatic tissues including lymph node, leukocytes, tonsil, bone marrow and spleen. Expressed to a lesser extent in thymus, lung and liver.
  • Sequence similarities
    Contains 2 DRADA repeats.
  • Information by UniProt
  • Database links
  • Alternative names
    • C20orf183 antibody
    • DAI antibody
    • DLM 1 antibody
    • DLM1 antibody
    • DNA-dependent activator of interferon regulatory factors antibody
    • DNA-dependent activator of IRFs antibody
    • OTTHUMP00000031373 antibody
    • OTTHUMP00000174290 antibody
    • OTTHUMP00000237854 antibody
    • Tumor stroma and activated macrophage protein DLM 1 antibody
    • Tumor stroma and activated macrophage protein DLM-1 antibody
    • Z-DNA-binding protein 1 antibody
    • ZBP 1 antibody
    • Zbp1 antibody
    • ZBP1_HUMAN antibody
    • ZDBP1 antibody
    see all

Images

  • Anti-Z DNA binding protein antibody (ab32927) at 5 µg/ml + Jurkat cell lysate

    Secondary
    HRP conjugated anti-Rabbit IgG 1: 50,000 - 100,000

    Predicted band size : 46 kDa
    Observed band size : 46 kDa

References

ab32927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products. I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused...

Read More

Thank you for your enquiry and your interest in our products. I have quickly checked our on-line catalogue and currently the only antibody is available against this target is ab32927 which has been characterised for cross-reaction with human only. ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up