Anti-ZAP70 antibody [SBZAP] (Alkaline Phosphatase) (ab25608)

Overview

  • Product nameAnti-ZAP70 antibody [SBZAP] (Alkaline Phosphatase)
    See all ZAP70 primary antibodies
  • Description
    Mouse monoclonal [SBZAP] to ZAP70 (Alkaline Phosphatase)
  • ConjugationAlkaline Phosphatase
  • Tested applicationsSuitable for: ELISA, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide:

    PQRRIDTLNSDGYTPEPARITSPDKPRPMP

    conjugated to KLH, corresponding to amino acids 280-309 of Human ZAP70

Properties

Applications

Our Abpromise guarantee covers the use of ab25608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/500 - 1/1000.
Flow Cyt Use at an assay dependent dilution.

Target

  • FunctionPlays a role in T-cell development and lymphocyte activation. Essential for TCR-mediated IL-2 production. Isoform 1 induces TCR-mediated signal transduction, isoform 2 does not.
  • Tissue specificityExpressed in T- and natural killer cells.
  • Involvement in diseaseDefects in ZAP70 are the cause of selective T-cell defect (STD) [MIM:176947]. STD is an autosomal recessive form of severe combined immunodeficiency characterized by a selective absence of CD8-type T-cells.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. SYK/ZAP-70 subfamily.
    Contains 1 protein kinase domain.
    Contains 2 SH2 domains.
  • DomainThe SH2 domains bind to the phosphorylated tyrosine-based activation motif (TAM) of CD3Z and the non-canonical phosphorylated tyrosine-based activation motif (TAM) of RHOH.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues upon T-cell antigen receptor (TCR) stimulation. Tyr-319 phosphorylation is essential for full activity.
  • Cellular localizationCytoplasm. Cell membrane. After antigen stimulation, isoform 1 concentrates at the immunological synapse and isoform 2 remains cytoplasmic. Co-localizes together with RHOH in the immunological synapse. RHOH is required for its proper localization to the cell membrane and cytoskeleton fractions in the thymocytes.
  • Information by UniProt
  • Database links
  • Alternative names
    • 70 kDa zeta associated protein antibody
    • 70 kDa zeta-associated protein antibody
    • EC 2.7.10.2 antibody
    • FLJ17670 antibody
    • FLJ17679 antibody
    • Selective T cell defect antibody
    • SRK antibody
    • STD antibody
    • Syk related tyrosine kinase antibody
    • Syk-related tyrosine kinase antibody
    • Truncated ZAP kinase antibody
    • Tyrosine protein kinase ZAP70 antibody
    • Tyrosine-protein kinase ZAP-70 antibody
    • TZK antibody
    • ZAP 70 antibody
    • ZAP70 antibody
    • ZAP70_HUMAN antibody
    • Zeta chain associated protein kinase 70kD antibody
    • Zeta chain associated protein kinase 70kDa antibody
    • Zeta chain associated protein kinase 70kDa isoform 1 antibody
    • Zeta chain associated protein kinase 70kDa isoform 2 antibody
    • Zeta chain TCR associated protein kinase 70kD antibody
    • Zeta chain TCR associated protein kinase 70kDa antibody
    see all

References for Anti-ZAP70 antibody [SBZAP] (Alkaline Phosphatase) (ab25608)

ab25608 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab25608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"