Overview

  • Product name
    Anti-ZBED2 antibody
  • Description
    Rabbit polyclonal to ZBED2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human ZBED2 aa 83-132 (internal sequence). The exact sequence is proprietary. NP_078784.2.
    Sequence:

    RQVSRGPGVNVGTTALWKHLKSMHREELEKSGHGQAGQRQDPRPHGPQLP


    Database link: Q9BTP6

Properties

Applications

Our Abpromise guarantee covers the use of ab186494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 25 kDa.

Target

Images

  • Western blot analysis of HepG2 whole cell lysate labelling ZBED2 with ab186494 at 1.0µg/ml.

References

ab186494 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up