Overview

  • Product nameAnti-ZDHHC18 antibody
    See all ZDHHC18 primary antibodies
  • Description
    Rabbit polyclonal to ZDHHC18
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (

    SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK

    ) of Human ZDHHC18 (NP_115659).

  • Positive control
    • OVCAR3 lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-ZDHHC18 antibody images

  • Anti-ZDHHC18 antibody (ab99183) at 1 µg/ml + OVCAR3 Cell Lysate at 10 µg

    Predicted band size : 42 kDa

References for Anti-ZDHHC18 antibody (ab99183)

ab99183 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"